Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4Z3Y0

Protein Details
Accession A0A0F4Z3Y0   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
256-280GDCNGGARPKKPKKTKSDGWPPLSSHydrophilic
NLS Segment(s)
PositionSequence
218-272PRRRSSRMAQLRPARQTPSSVRRIIGGRGGRGKKRGRDGDCNGGARPKKPKKTKS
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016024  ARM-type_fold  
Amino Acid Sequences MIPSWFRLREVMPSDPQDPANAMEVNQLHRALTSLLILPDTEQRIEERFSRPLPPYDPHNASVIQYRTLNPGPHHSNVAFADHLFLLHTASYPRVPAASVMSLEQDQDNNITGACHSRQRTLEWLEQLSRVPPENPRVPSHGLLTGTPPRVLPETNLKEDEMSEDGNDGDDEYEDEEDEEEEDDDDDNDNDNDENKGGNDRDSLRVNVLDEPRTASGPRRRSSRMAQLRPARQTPSSVRRIIGGRGGRGKKRGRDGDCNGGARPKKPKKTKSDGWPPLSSLRRSSRLAGAASTGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.41
4 0.34
5 0.3
6 0.25
7 0.24
8 0.19
9 0.18
10 0.21
11 0.22
12 0.24
13 0.26
14 0.24
15 0.2
16 0.19
17 0.2
18 0.15
19 0.14
20 0.13
21 0.12
22 0.12
23 0.12
24 0.12
25 0.12
26 0.17
27 0.18
28 0.17
29 0.15
30 0.16
31 0.19
32 0.22
33 0.24
34 0.24
35 0.26
36 0.28
37 0.33
38 0.35
39 0.38
40 0.4
41 0.39
42 0.41
43 0.45
44 0.46
45 0.42
46 0.41
47 0.36
48 0.33
49 0.37
50 0.32
51 0.26
52 0.24
53 0.23
54 0.27
55 0.29
56 0.32
57 0.26
58 0.33
59 0.35
60 0.35
61 0.38
62 0.32
63 0.33
64 0.3
65 0.31
66 0.23
67 0.18
68 0.18
69 0.13
70 0.13
71 0.1
72 0.09
73 0.07
74 0.07
75 0.07
76 0.06
77 0.08
78 0.08
79 0.08
80 0.09
81 0.08
82 0.08
83 0.09
84 0.1
85 0.1
86 0.1
87 0.1
88 0.11
89 0.11
90 0.11
91 0.11
92 0.08
93 0.08
94 0.08
95 0.08
96 0.07
97 0.07
98 0.06
99 0.06
100 0.09
101 0.1
102 0.15
103 0.15
104 0.2
105 0.21
106 0.23
107 0.28
108 0.3
109 0.33
110 0.3
111 0.31
112 0.27
113 0.27
114 0.25
115 0.21
116 0.17
117 0.14
118 0.13
119 0.14
120 0.19
121 0.24
122 0.26
123 0.27
124 0.3
125 0.32
126 0.32
127 0.3
128 0.27
129 0.22
130 0.19
131 0.2
132 0.21
133 0.19
134 0.18
135 0.16
136 0.15
137 0.15
138 0.15
139 0.14
140 0.19
141 0.23
142 0.25
143 0.26
144 0.25
145 0.24
146 0.24
147 0.24
148 0.15
149 0.11
150 0.08
151 0.07
152 0.07
153 0.07
154 0.07
155 0.05
156 0.04
157 0.04
158 0.04
159 0.05
160 0.05
161 0.05
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.05
169 0.05
170 0.05
171 0.06
172 0.06
173 0.06
174 0.07
175 0.07
176 0.07
177 0.07
178 0.07
179 0.08
180 0.07
181 0.07
182 0.07
183 0.11
184 0.11
185 0.12
186 0.14
187 0.16
188 0.2
189 0.22
190 0.23
191 0.2
192 0.21
193 0.21
194 0.24
195 0.24
196 0.22
197 0.19
198 0.22
199 0.21
200 0.21
201 0.21
202 0.24
203 0.29
204 0.36
205 0.41
206 0.44
207 0.47
208 0.52
209 0.58
210 0.61
211 0.63
212 0.62
213 0.66
214 0.69
215 0.72
216 0.73
217 0.69
218 0.62
219 0.53
220 0.52
221 0.51
222 0.51
223 0.51
224 0.47
225 0.44
226 0.44
227 0.45
228 0.41
229 0.4
230 0.35
231 0.34
232 0.41
233 0.47
234 0.48
235 0.54
236 0.6
237 0.6
238 0.66
239 0.7
240 0.68
241 0.71
242 0.73
243 0.75
244 0.73
245 0.68
246 0.59
247 0.58
248 0.54
249 0.49
250 0.54
251 0.54
252 0.58
253 0.66
254 0.75
255 0.77
256 0.84
257 0.88
258 0.88
259 0.89
260 0.89
261 0.85
262 0.79
263 0.72
264 0.7
265 0.68
266 0.6
267 0.56
268 0.54
269 0.53
270 0.53
271 0.53
272 0.51
273 0.49
274 0.48
275 0.41