Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4YRJ6

Protein Details
Accession A0A0F4YRJ6    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
53-80GTVYHKEYRKRNQKGGRRKTGRNINKDNBasic
NLS Segment(s)
PositionSequence
61-74RKRNQKGGRRKTGR
Subcellular Location(s) mito_nucl 12.666, nucl 12.5, mito 11.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences RCPTQQCRMKQLPRKAAIGRTPDHVTRMNIEDHEEWYTGWYTNGIRNGIRTKGTVYHKEYRKRNQKGGRRKTGRNINKDNYTHVSSLSLLALNSIHLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.71
3 0.68
4 0.65
5 0.61
6 0.53
7 0.48
8 0.47
9 0.42
10 0.41
11 0.37
12 0.32
13 0.29
14 0.29
15 0.26
16 0.22
17 0.25
18 0.22
19 0.2
20 0.21
21 0.18
22 0.15
23 0.14
24 0.15
25 0.11
26 0.1
27 0.1
28 0.09
29 0.12
30 0.14
31 0.14
32 0.13
33 0.16
34 0.18
35 0.19
36 0.19
37 0.16
38 0.15
39 0.21
40 0.26
41 0.3
42 0.34
43 0.41
44 0.47
45 0.55
46 0.61
47 0.65
48 0.71
49 0.71
50 0.75
51 0.76
52 0.79
53 0.82
54 0.85
55 0.85
56 0.82
57 0.81
58 0.81
59 0.83
60 0.82
61 0.81
62 0.79
63 0.76
64 0.77
65 0.72
66 0.68
67 0.63
68 0.57
69 0.48
70 0.39
71 0.33
72 0.25
73 0.25
74 0.2
75 0.15
76 0.11
77 0.11
78 0.11