Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7RXH8

Protein Details
Accession R7RXH8    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
22-42YYSRHKILRPRHKTEHRTPSVBasic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 1, cyto 1, extr 1, cyto_nucl 1
Family & Domain DBs
KEGG shs:STEHIDRAFT_135585  -  
Amino Acid Sequences MMPTKTPWSLLLLAILIHRFHYYSRHKILRPRHKTEHRTPSVDDQVKEAVKWVQLEYVKKYHEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.11
4 0.1
5 0.1
6 0.09
7 0.1
8 0.18
9 0.23
10 0.29
11 0.37
12 0.42
13 0.45
14 0.52
15 0.62
16 0.65
17 0.67
18 0.67
19 0.69
20 0.73
21 0.78
22 0.8
23 0.81
24 0.75
25 0.69
26 0.64
27 0.61
28 0.62
29 0.58
30 0.49
31 0.4
32 0.4
33 0.37
34 0.34
35 0.29
36 0.21
37 0.19
38 0.2
39 0.19
40 0.2
41 0.24
42 0.28
43 0.32
44 0.36