Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7RW70

Protein Details
Accession R7RW70    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
35-54KKHRIPTKTYAKPRIIRNVDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, nucl 5, mito 5, pero 5, mito_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
KEGG shs:STEHIDRAFT_33401  -  
Pfam View protein in Pfam  
PF13650  Asp_protease_2  
CDD cd00303  retropepsin_like  
Amino Acid Sequences MRFPIYINGGNKDVETKALIDSGATGLFIHWNFVKKHRIPTKTYAKPRIIRNVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.12
4 0.11
5 0.11
6 0.11
7 0.08
8 0.08
9 0.07
10 0.06
11 0.05
12 0.05
13 0.04
14 0.06
15 0.06
16 0.07
17 0.08
18 0.12
19 0.13
20 0.18
21 0.27
22 0.28
23 0.39
24 0.46
25 0.51
26 0.52
27 0.61
28 0.67
29 0.68
30 0.76
31 0.75
32 0.75
33 0.76
34 0.79