Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7RVY8

Protein Details
Accession R7RVY8   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
39-59SESNRHRSNRLPRRKDPQPTIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
KEGG shs:STEHIDRAFT_32507  -  
Amino Acid Sequences MTYLGTSDGGHGNIFMRENNSMFTAAHALFDENLFPRCSESNRHRSNRLPRRKDPQPTIPPDDDGDVPPHQHYPPERRPDPEQDVAPPAAPQRDPSPPPQPRNEPPAPLPEPRQSNDQNQVPGPSSEPNTSGHGEPSVAPGDEAGILARLCREGGAELIHFLMAKAVPLEGEFRPAENVREWTYKDIARLPKAER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.15
4 0.17
5 0.18
6 0.19
7 0.19
8 0.18
9 0.17
10 0.17
11 0.18
12 0.15
13 0.15
14 0.14
15 0.13
16 0.13
17 0.13
18 0.13
19 0.11
20 0.13
21 0.13
22 0.12
23 0.14
24 0.16
25 0.19
26 0.25
27 0.33
28 0.42
29 0.51
30 0.56
31 0.59
32 0.66
33 0.75
34 0.77
35 0.79
36 0.77
37 0.75
38 0.79
39 0.82
40 0.83
41 0.79
42 0.79
43 0.78
44 0.76
45 0.75
46 0.67
47 0.6
48 0.51
49 0.45
50 0.35
51 0.27
52 0.23
53 0.16
54 0.16
55 0.15
56 0.17
57 0.15
58 0.17
59 0.2
60 0.26
61 0.34
62 0.42
63 0.43
64 0.45
65 0.5
66 0.54
67 0.56
68 0.5
69 0.43
70 0.35
71 0.36
72 0.32
73 0.28
74 0.21
75 0.15
76 0.13
77 0.12
78 0.12
79 0.12
80 0.17
81 0.19
82 0.23
83 0.32
84 0.37
85 0.41
86 0.45
87 0.48
88 0.47
89 0.54
90 0.51
91 0.43
92 0.38
93 0.42
94 0.4
95 0.36
96 0.36
97 0.33
98 0.35
99 0.34
100 0.38
101 0.34
102 0.36
103 0.41
104 0.4
105 0.37
106 0.34
107 0.34
108 0.29
109 0.26
110 0.23
111 0.18
112 0.17
113 0.16
114 0.17
115 0.17
116 0.19
117 0.2
118 0.19
119 0.17
120 0.15
121 0.15
122 0.14
123 0.14
124 0.13
125 0.11
126 0.1
127 0.09
128 0.09
129 0.09
130 0.08
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.06
137 0.06
138 0.06
139 0.07
140 0.06
141 0.08
142 0.1
143 0.09
144 0.1
145 0.1
146 0.1
147 0.09
148 0.08
149 0.09
150 0.07
151 0.07
152 0.07
153 0.07
154 0.07
155 0.07
156 0.11
157 0.09
158 0.14
159 0.14
160 0.14
161 0.19
162 0.2
163 0.23
164 0.23
165 0.27
166 0.28
167 0.32
168 0.34
169 0.34
170 0.38
171 0.37
172 0.37
173 0.4
174 0.44
175 0.44