Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7RY11

Protein Details
Accession R7RY11    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
108-128LTKGASPHKKKSKSSPSERLSHydrophilic
NLS Segment(s)
PositionSequence
114-120PHKKKSK
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 6, cyto 4
Family & Domain DBs
KEGG shs:STEHIDRAFT_126375  -  
Amino Acid Sequences MNGSERTRSVAEHGYPKPPTSSLAALPQSPWTRTTSPWIVRYRQIVWTTKDLTSENASTLYNTCTPCPDGIQVLYEAIEPKVYQYVSVSACSKEGTRKQSRVRNMEELTKGASPHKKKSKSSPSERLSSGPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.42
3 0.43
4 0.41
5 0.34
6 0.32
7 0.28
8 0.28
9 0.23
10 0.29
11 0.29
12 0.27
13 0.27
14 0.32
15 0.3
16 0.28
17 0.27
18 0.25
19 0.25
20 0.26
21 0.32
22 0.34
23 0.36
24 0.43
25 0.46
26 0.44
27 0.46
28 0.49
29 0.44
30 0.42
31 0.41
32 0.39
33 0.37
34 0.39
35 0.38
36 0.35
37 0.34
38 0.28
39 0.26
40 0.24
41 0.21
42 0.16
43 0.14
44 0.14
45 0.12
46 0.12
47 0.12
48 0.13
49 0.13
50 0.12
51 0.13
52 0.13
53 0.13
54 0.14
55 0.12
56 0.1
57 0.09
58 0.1
59 0.09
60 0.08
61 0.08
62 0.07
63 0.07
64 0.06
65 0.06
66 0.05
67 0.06
68 0.08
69 0.08
70 0.08
71 0.08
72 0.12
73 0.13
74 0.15
75 0.16
76 0.14
77 0.15
78 0.15
79 0.16
80 0.19
81 0.25
82 0.32
83 0.39
84 0.47
85 0.55
86 0.62
87 0.7
88 0.71
89 0.71
90 0.7
91 0.65
92 0.64
93 0.57
94 0.5
95 0.44
96 0.38
97 0.33
98 0.31
99 0.37
100 0.36
101 0.44
102 0.53
103 0.58
104 0.63
105 0.73
106 0.78
107 0.79
108 0.84
109 0.84
110 0.8
111 0.78
112 0.74