Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7RYF8

Protein Details
Accession R7RYF8    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-28HTKSHTLCRRCGRRAFHKQHKECAQCHydrophilic
NLS Segment(s)
PositionSequence
44-49AKRRKT
Subcellular Location(s) mito 10, cyto 9.5, cyto_nucl 9, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG shs:STEHIDRAFT_42773  -  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
Amino Acid Sequences KRHTKSHTLCRRCGRRAFHKQHKECAQCGYPSAKLRSYEWGQKAKRRKTTGTGRMRYLKDVSRRFKNGFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.77
3 0.81
4 0.83
5 0.83
6 0.85
7 0.82
8 0.84
9 0.84
10 0.77
11 0.67
12 0.63
13 0.54
14 0.44
15 0.41
16 0.35
17 0.3
18 0.3
19 0.3
20 0.28
21 0.26
22 0.26
23 0.3
24 0.3
25 0.33
26 0.34
27 0.41
28 0.41
29 0.47
30 0.56
31 0.59
32 0.65
33 0.64
34 0.63
35 0.63
36 0.7
37 0.73
38 0.74
39 0.71
40 0.68
41 0.71
42 0.68
43 0.63
44 0.57
45 0.54
46 0.53
47 0.58
48 0.59
49 0.61
50 0.66