Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7S162

Protein Details
Accession R7S162    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
91-124SRLRSHPLPCPHRRSRRPPRPRYRTTPSPPSRPSBasic
NLS Segment(s)
PositionSequence
102-113HRRSRRPPRPRY
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
KEGG shs:STEHIDRAFT_125881  -  
Amino Acid Sequences IFDYSSEEERKWWTPESSASPGIALAHGSVPAPAPDYAHDYAHVTALEHCEPKRYHHQSQYQYQHITLPQQSSNHMNTRRLSTLPTPPLPSRLRSHPLPCPHRRSRRPPRPRYRTTPSPPSRPSTNFTSQARRNSATPTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.4
4 0.4
5 0.38
6 0.35
7 0.3
8 0.28
9 0.26
10 0.2
11 0.13
12 0.08
13 0.07
14 0.07
15 0.07
16 0.07
17 0.07
18 0.07
19 0.09
20 0.08
21 0.09
22 0.1
23 0.15
24 0.16
25 0.16
26 0.17
27 0.16
28 0.17
29 0.17
30 0.16
31 0.11
32 0.11
33 0.13
34 0.15
35 0.15
36 0.15
37 0.2
38 0.2
39 0.25
40 0.34
41 0.39
42 0.43
43 0.49
44 0.58
45 0.58
46 0.67
47 0.69
48 0.62
49 0.55
50 0.49
51 0.43
52 0.35
53 0.32
54 0.24
55 0.19
56 0.17
57 0.17
58 0.18
59 0.19
60 0.22
61 0.25
62 0.26
63 0.28
64 0.27
65 0.31
66 0.31
67 0.28
68 0.28
69 0.25
70 0.29
71 0.31
72 0.32
73 0.32
74 0.31
75 0.37
76 0.36
77 0.37
78 0.33
79 0.35
80 0.38
81 0.39
82 0.43
83 0.44
84 0.52
85 0.57
86 0.61
87 0.64
88 0.69
89 0.75
90 0.79
91 0.83
92 0.85
93 0.87
94 0.9
95 0.92
96 0.93
97 0.92
98 0.92
99 0.9
100 0.88
101 0.87
102 0.85
103 0.85
104 0.81
105 0.8
106 0.76
107 0.73
108 0.71
109 0.64
110 0.6
111 0.57
112 0.57
113 0.55
114 0.55
115 0.59
116 0.59
117 0.64
118 0.66
119 0.61
120 0.54