Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7RX27

Protein Details
Accession R7RX27    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
76-97SELNREPKRRRRWALSGLDKGRBasic
NLS Segment(s)
PositionSequence
82-87PKRRRR
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
KEGG shs:STEHIDRAFT_163151  -  
Amino Acid Sequences MGAVMRGRCHRGERSDGSSRRTGSVEDENEEDALEAVGDGAPEPPSAGRQRERARERRQLWAADEKRTVDGAGSGSELNREPKRRRRWALSGLDKGRISMAGTGSAASF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.59
3 0.6
4 0.59
5 0.58
6 0.53
7 0.47
8 0.42
9 0.35
10 0.3
11 0.34
12 0.31
13 0.28
14 0.28
15 0.26
16 0.25
17 0.24
18 0.19
19 0.11
20 0.08
21 0.06
22 0.04
23 0.03
24 0.03
25 0.03
26 0.03
27 0.04
28 0.04
29 0.04
30 0.05
31 0.05
32 0.08
33 0.11
34 0.15
35 0.17
36 0.25
37 0.31
38 0.4
39 0.48
40 0.54
41 0.59
42 0.65
43 0.65
44 0.65
45 0.63
46 0.56
47 0.51
48 0.52
49 0.47
50 0.41
51 0.41
52 0.33
53 0.3
54 0.29
55 0.25
56 0.15
57 0.13
58 0.1
59 0.09
60 0.09
61 0.08
62 0.07
63 0.09
64 0.1
65 0.15
66 0.2
67 0.27
68 0.35
69 0.45
70 0.56
71 0.65
72 0.71
73 0.74
74 0.78
75 0.8
76 0.82
77 0.82
78 0.81
79 0.74
80 0.72
81 0.64
82 0.55
83 0.46
84 0.36
85 0.27
86 0.21
87 0.19
88 0.14
89 0.15