Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7RW11

Protein Details
Accession R7RW11   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
153-177TTDSCSPKSTRKRRVPPPRMRWPLLHydrophilic
NLS Segment(s)
PositionSequence
164-166KRR
Subcellular Location(s) plas 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR003855  K+_transporter  
Gene Ontology GO:0016020  C:membrane  
GO:0015079  F:potassium ion transmembrane transporter activity  
KEGG shs:STEHIDRAFT_163629  -  
Pfam View protein in Pfam  
PF02705  K_trans  
Amino Acid Sequences MLSSAVDTEHYAFHGDDRLKSEAPQTAWLDGNPSAVTSSGAETRRMSEGKGSWGLLALSFQTLGIIYSDVDTSPVYTMNGLWPATGPVPSAEDVVGGISAIVWALTIIPLVKYVFIALRFGTGEGEGGIFALYQGLYPSIYLAASDFVTNVSTTDSCSPKSTRKRRVPPPRMRWPLLIWALFGTSLTMADGVFTAAVSVTSAVGGIAVAKPEVANSVVPISIGFLLVLFLAQPFGTHKLSVVFAPGTVHSSALHFGSIADLELADVEGYSQYEVTGIWLLLIAGSGITNIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.22
4 0.26
5 0.3
6 0.29
7 0.3
8 0.33
9 0.32
10 0.31
11 0.35
12 0.33
13 0.31
14 0.32
15 0.3
16 0.3
17 0.24
18 0.24
19 0.17
20 0.15
21 0.13
22 0.12
23 0.13
24 0.1
25 0.12
26 0.16
27 0.17
28 0.19
29 0.2
30 0.22
31 0.26
32 0.26
33 0.25
34 0.25
35 0.25
36 0.29
37 0.31
38 0.29
39 0.24
40 0.24
41 0.23
42 0.17
43 0.16
44 0.1
45 0.08
46 0.07
47 0.07
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.05
54 0.06
55 0.06
56 0.06
57 0.07
58 0.07
59 0.07
60 0.07
61 0.08
62 0.07
63 0.07
64 0.08
65 0.09
66 0.12
67 0.11
68 0.1
69 0.1
70 0.11
71 0.12
72 0.12
73 0.1
74 0.08
75 0.1
76 0.1
77 0.11
78 0.09
79 0.08
80 0.08
81 0.07
82 0.06
83 0.04
84 0.04
85 0.03
86 0.03
87 0.02
88 0.02
89 0.02
90 0.02
91 0.02
92 0.02
93 0.03
94 0.03
95 0.03
96 0.04
97 0.05
98 0.05
99 0.05
100 0.06
101 0.07
102 0.07
103 0.08
104 0.07
105 0.08
106 0.08
107 0.09
108 0.08
109 0.07
110 0.06
111 0.05
112 0.05
113 0.04
114 0.04
115 0.04
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.05
140 0.07
141 0.1
142 0.11
143 0.12
144 0.15
145 0.17
146 0.25
147 0.35
148 0.44
149 0.51
150 0.6
151 0.69
152 0.78
153 0.87
154 0.89
155 0.9
156 0.89
157 0.9
158 0.87
159 0.8
160 0.72
161 0.62
162 0.59
163 0.52
164 0.42
165 0.31
166 0.24
167 0.21
168 0.18
169 0.16
170 0.09
171 0.05
172 0.04
173 0.04
174 0.04
175 0.03
176 0.04
177 0.04
178 0.04
179 0.03
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.03
189 0.03
190 0.03
191 0.03
192 0.04
193 0.04
194 0.04
195 0.04
196 0.04
197 0.04
198 0.05
199 0.06
200 0.06
201 0.06
202 0.07
203 0.08
204 0.08
205 0.08
206 0.08
207 0.08
208 0.07
209 0.07
210 0.06
211 0.05
212 0.05
213 0.05
214 0.05
215 0.04
216 0.03
217 0.04
218 0.04
219 0.04
220 0.07
221 0.11
222 0.13
223 0.13
224 0.13
225 0.15
226 0.16
227 0.16
228 0.17
229 0.13
230 0.12
231 0.13
232 0.13
233 0.14
234 0.13
235 0.14
236 0.11
237 0.12
238 0.13
239 0.12
240 0.11
241 0.09
242 0.08
243 0.09
244 0.09
245 0.08
246 0.07
247 0.06
248 0.06
249 0.06
250 0.06
251 0.05
252 0.04
253 0.04
254 0.05
255 0.06
256 0.06
257 0.06
258 0.05
259 0.06
260 0.06
261 0.08
262 0.09
263 0.08
264 0.08
265 0.08
266 0.08
267 0.08
268 0.08
269 0.05
270 0.04
271 0.04