Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7RVH4

Protein Details
Accession R7RVH4    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
149-178DGGKRTRWTKCDARRQTRRRAPTRNASSMAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 12, cyto 9, mito 5
Family & Domain DBs
KEGG shs:STEHIDRAFT_164102  -  
Amino Acid Sequences MRCVSLRERITYDTNEGSHDRAAGAADTPCELENGGKREWANIMEEKNKTNEQYGTNTYNTRRCWVPSPWDPPEGHTIPPKHPPPPSASFLDALSHWRALSVVAVEHDSDRASKWPPREEASSEGKEEASEGGEDERGQRERRRDSEGDGGKRTRWTKCDARRQTRRRAPTRNASSMAPTVVVAVPNREGVALAGGVPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.32
4 0.3
5 0.26
6 0.23
7 0.18
8 0.14
9 0.14
10 0.11
11 0.12
12 0.1
13 0.1
14 0.1
15 0.11
16 0.11
17 0.1
18 0.1
19 0.11
20 0.16
21 0.2
22 0.2
23 0.22
24 0.22
25 0.23
26 0.25
27 0.23
28 0.21
29 0.22
30 0.26
31 0.29
32 0.31
33 0.31
34 0.33
35 0.34
36 0.31
37 0.3
38 0.29
39 0.26
40 0.29
41 0.32
42 0.32
43 0.32
44 0.34
45 0.34
46 0.37
47 0.35
48 0.33
49 0.3
50 0.29
51 0.32
52 0.33
53 0.38
54 0.4
55 0.46
56 0.47
57 0.49
58 0.47
59 0.43
60 0.46
61 0.39
62 0.33
63 0.31
64 0.3
65 0.29
66 0.37
67 0.37
68 0.34
69 0.34
70 0.34
71 0.35
72 0.38
73 0.38
74 0.33
75 0.32
76 0.28
77 0.27
78 0.26
79 0.19
80 0.16
81 0.14
82 0.11
83 0.09
84 0.09
85 0.08
86 0.08
87 0.08
88 0.05
89 0.05
90 0.05
91 0.05
92 0.06
93 0.06
94 0.06
95 0.06
96 0.06
97 0.06
98 0.08
99 0.11
100 0.14
101 0.18
102 0.23
103 0.25
104 0.28
105 0.31
106 0.32
107 0.34
108 0.38
109 0.36
110 0.31
111 0.29
112 0.26
113 0.22
114 0.2
115 0.15
116 0.09
117 0.07
118 0.06
119 0.06
120 0.07
121 0.07
122 0.08
123 0.12
124 0.15
125 0.18
126 0.23
127 0.3
128 0.37
129 0.41
130 0.47
131 0.45
132 0.47
133 0.53
134 0.57
135 0.55
136 0.52
137 0.5
138 0.44
139 0.49
140 0.49
141 0.44
142 0.39
143 0.4
144 0.45
145 0.54
146 0.63
147 0.67
148 0.74
149 0.8
150 0.85
151 0.89
152 0.89
153 0.89
154 0.88
155 0.87
156 0.85
157 0.85
158 0.86
159 0.82
160 0.75
161 0.66
162 0.6
163 0.52
164 0.44
165 0.33
166 0.24
167 0.19
168 0.17
169 0.18
170 0.14
171 0.15
172 0.15
173 0.16
174 0.16
175 0.14
176 0.13
177 0.11
178 0.12
179 0.09