Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194S421

Protein Details
Accession A0A194S421    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
39-58ETFNNKTRRRWLPNVHSKRVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, nucl 10, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR034704  L28p-like  
IPR026569  Ribo_L28/L24  
IPR037147  Ribo_L28/L24_sf  
IPR001383  Ribosomal_L28  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00830  Ribosomal_L28  
Amino Acid Sequences MRPSLSLLKNTSRSALNYKRSQQGLYDGRSIQSGNNVGETFNNKTRRRWLPNVHSKRVYSEALGRSLALKVTAGALRTIDKVGGLDNYLFRMRPDRLGDKGMELRQMVQDAHAQIKATRRVATSGQIGEQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.48
3 0.48
4 0.51
5 0.55
6 0.6
7 0.59
8 0.56
9 0.48
10 0.49
11 0.47
12 0.42
13 0.41
14 0.34
15 0.33
16 0.32
17 0.31
18 0.22
19 0.2
20 0.2
21 0.16
22 0.17
23 0.17
24 0.16
25 0.18
26 0.21
27 0.21
28 0.25
29 0.33
30 0.33
31 0.36
32 0.45
33 0.52
34 0.57
35 0.61
36 0.63
37 0.65
38 0.75
39 0.8
40 0.78
41 0.72
42 0.64
43 0.58
44 0.53
45 0.42
46 0.32
47 0.3
48 0.25
49 0.23
50 0.23
51 0.2
52 0.16
53 0.16
54 0.14
55 0.08
56 0.06
57 0.05
58 0.06
59 0.07
60 0.07
61 0.07
62 0.07
63 0.08
64 0.09
65 0.09
66 0.08
67 0.07
68 0.06
69 0.07
70 0.07
71 0.07
72 0.07
73 0.07
74 0.1
75 0.1
76 0.1
77 0.1
78 0.15
79 0.15
80 0.2
81 0.26
82 0.28
83 0.3
84 0.33
85 0.34
86 0.33
87 0.38
88 0.34
89 0.31
90 0.27
91 0.26
92 0.24
93 0.25
94 0.21
95 0.16
96 0.19
97 0.17
98 0.2
99 0.2
100 0.19
101 0.19
102 0.27
103 0.32
104 0.32
105 0.33
106 0.32
107 0.34
108 0.36
109 0.39
110 0.37
111 0.32