Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194S7V7

Protein Details
Accession A0A194S7V7    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
67-89LAVKHRKALDSKKKRTRSSNTSDHydrophilic
NLS Segment(s)
PositionSequence
73-81KALDSKKKR
236-241RIRRKG
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MAPVQPLPDVPSLFAHIRQPDPPPVDLAQPAPLAHERAAVRSLASTVQRGPASTFLHDVVLTRSHTLAVKHRKALDSKKKRTRSSNTSDDDDDDDLVLADKGFVHKRRTRSTDTDDDAPTTATATSGDRRAASRKTAALRTRRIKGQLVKPEVHLDDVDLPPGFPSHDLLTSLHSHASHLLTSTHNLVPPPSASTSRLPPAAQAHFDALEQRAQAQEARLARWGTDAELKAVKATRIRRKGAGTRRALWADADRAFEGPALVALGMLAELLVQDAAAAPGELPLPPPPAPAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.28
4 0.31
5 0.33
6 0.36
7 0.39
8 0.41
9 0.4
10 0.38
11 0.35
12 0.35
13 0.34
14 0.3
15 0.26
16 0.23
17 0.22
18 0.22
19 0.23
20 0.22
21 0.2
22 0.24
23 0.21
24 0.22
25 0.24
26 0.2
27 0.18
28 0.17
29 0.18
30 0.16
31 0.17
32 0.17
33 0.16
34 0.22
35 0.22
36 0.22
37 0.22
38 0.24
39 0.25
40 0.24
41 0.25
42 0.2
43 0.21
44 0.2
45 0.19
46 0.15
47 0.16
48 0.16
49 0.15
50 0.14
51 0.15
52 0.17
53 0.19
54 0.26
55 0.33
56 0.38
57 0.42
58 0.45
59 0.48
60 0.53
61 0.61
62 0.63
63 0.63
64 0.69
65 0.74
66 0.8
67 0.82
68 0.85
69 0.84
70 0.82
71 0.8
72 0.79
73 0.73
74 0.68
75 0.62
76 0.54
77 0.46
78 0.37
79 0.29
80 0.19
81 0.14
82 0.1
83 0.1
84 0.08
85 0.05
86 0.04
87 0.04
88 0.07
89 0.12
90 0.17
91 0.24
92 0.29
93 0.36
94 0.44
95 0.5
96 0.54
97 0.56
98 0.59
99 0.59
100 0.58
101 0.56
102 0.48
103 0.43
104 0.36
105 0.29
106 0.22
107 0.14
108 0.11
109 0.06
110 0.06
111 0.07
112 0.09
113 0.1
114 0.11
115 0.11
116 0.13
117 0.17
118 0.18
119 0.19
120 0.2
121 0.22
122 0.25
123 0.31
124 0.36
125 0.39
126 0.46
127 0.48
128 0.5
129 0.49
130 0.49
131 0.47
132 0.48
133 0.49
134 0.49
135 0.49
136 0.46
137 0.44
138 0.44
139 0.38
140 0.32
141 0.24
142 0.16
143 0.14
144 0.13
145 0.13
146 0.1
147 0.09
148 0.09
149 0.09
150 0.08
151 0.05
152 0.07
153 0.07
154 0.08
155 0.09
156 0.09
157 0.12
158 0.13
159 0.14
160 0.14
161 0.12
162 0.12
163 0.13
164 0.13
165 0.11
166 0.1
167 0.1
168 0.1
169 0.11
170 0.15
171 0.14
172 0.14
173 0.14
174 0.14
175 0.13
176 0.13
177 0.15
178 0.13
179 0.14
180 0.16
181 0.19
182 0.22
183 0.24
184 0.25
185 0.22
186 0.23
187 0.26
188 0.26
189 0.25
190 0.22
191 0.21
192 0.19
193 0.2
194 0.19
195 0.14
196 0.13
197 0.12
198 0.11
199 0.11
200 0.11
201 0.12
202 0.11
203 0.15
204 0.15
205 0.17
206 0.2
207 0.2
208 0.19
209 0.2
210 0.19
211 0.16
212 0.21
213 0.2
214 0.19
215 0.21
216 0.2
217 0.21
218 0.22
219 0.23
220 0.23
221 0.32
222 0.39
223 0.46
224 0.5
225 0.53
226 0.59
227 0.66
228 0.7
229 0.71
230 0.67
231 0.63
232 0.65
233 0.62
234 0.55
235 0.48
236 0.41
237 0.37
238 0.33
239 0.32
240 0.26
241 0.24
242 0.24
243 0.21
244 0.17
245 0.11
246 0.09
247 0.07
248 0.06
249 0.05
250 0.05
251 0.04
252 0.04
253 0.04
254 0.03
255 0.02
256 0.02
257 0.03
258 0.03
259 0.03
260 0.03
261 0.03
262 0.04
263 0.04
264 0.05
265 0.04
266 0.06
267 0.06
268 0.07
269 0.08
270 0.11
271 0.15
272 0.15