Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0N8PZR3

Protein Details
Accession A0A0N8PZR3    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
88-111EVLAKTMSGRKRQRKGYKGSAGNGHydrophilic
NLS Segment(s)
PositionSequence
84-115KKTKEVLAKTMSGRKRQRKGYKGSAGNGGARK
Subcellular Location(s) cyto 13, cyto_nucl 10.5, mito 7, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR039883  Fcf2/DNTTIP2  
IPR014810  Fcf2_C  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08698  Fcf2  
Amino Acid Sequences MPATPMTPQLKRELDALRLSAALDPKRFLRGGAKRDKVGEFFQVGHVVAPSTRATTASTAPRVHKRGFVEELVESEEAQAYARKKTKEVLAKTMSGRKRQRKGYKGSAGNGGARK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.36
3 0.34
4 0.27
5 0.25
6 0.24
7 0.21
8 0.23
9 0.22
10 0.2
11 0.21
12 0.21
13 0.25
14 0.24
15 0.23
16 0.27
17 0.32
18 0.39
19 0.48
20 0.51
21 0.49
22 0.52
23 0.53
24 0.46
25 0.4
26 0.34
27 0.25
28 0.22
29 0.21
30 0.19
31 0.17
32 0.14
33 0.12
34 0.09
35 0.07
36 0.08
37 0.07
38 0.07
39 0.07
40 0.08
41 0.08
42 0.1
43 0.13
44 0.14
45 0.17
46 0.19
47 0.22
48 0.28
49 0.31
50 0.3
51 0.32
52 0.31
53 0.33
54 0.34
55 0.31
56 0.27
57 0.23
58 0.23
59 0.2
60 0.18
61 0.13
62 0.1
63 0.1
64 0.07
65 0.08
66 0.1
67 0.1
68 0.16
69 0.21
70 0.22
71 0.24
72 0.27
73 0.35
74 0.41
75 0.45
76 0.47
77 0.46
78 0.49
79 0.53
80 0.57
81 0.55
82 0.55
83 0.61
84 0.62
85 0.67
86 0.73
87 0.8
88 0.8
89 0.84
90 0.85
91 0.85
92 0.82
93 0.77
94 0.74
95 0.66