Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0N8PZM8

Protein Details
Accession A0A0N8PZM8    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
31-110APHLCLRHPRRPRSRTTRRTRPSRRSRRPSRPSSRTCRPRRQRAAPSSAAESRRVEKNDYLRRRRRRSPASSRPARRVDGHydrophilic
NLS Segment(s)
PositionSequence
38-110HPRRPRSRTTRRTRPSRRSRRPSRPSSRTCRPRRQRAAPSSAAESRRVEKNDYLRRRRRRSPASSRPARRVDG
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences ATSQSARPRFISAQPSNPRNSTITTSAGSTAPHLCLRHPRRPRSRTTRRTRPSRRSRRPSRPSSRTCRPRRQRAAPSSAAESRRVEKNDYLRRRRRRSPASSRPARRVDGRVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.6
3 0.59
4 0.57
5 0.53
6 0.45
7 0.43
8 0.37
9 0.32
10 0.3
11 0.26
12 0.25
13 0.24
14 0.23
15 0.2
16 0.17
17 0.15
18 0.14
19 0.17
20 0.16
21 0.16
22 0.26
23 0.33
24 0.41
25 0.48
26 0.56
27 0.64
28 0.69
29 0.77
30 0.78
31 0.82
32 0.83
33 0.84
34 0.85
35 0.83
36 0.89
37 0.89
38 0.89
39 0.89
40 0.9
41 0.91
42 0.9
43 0.92
44 0.92
45 0.91
46 0.91
47 0.9
48 0.88
49 0.86
50 0.84
51 0.84
52 0.83
53 0.83
54 0.84
55 0.83
56 0.84
57 0.86
58 0.87
59 0.87
60 0.84
61 0.82
62 0.76
63 0.69
64 0.62
65 0.58
66 0.5
67 0.43
68 0.37
69 0.33
70 0.35
71 0.35
72 0.33
73 0.34
74 0.42
75 0.5
76 0.58
77 0.65
78 0.69
79 0.78
80 0.83
81 0.87
82 0.87
83 0.87
84 0.88
85 0.88
86 0.89
87 0.89
88 0.91
89 0.89
90 0.87
91 0.83
92 0.78
93 0.73