Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194SC57

Protein Details
Accession A0A194SC57   
Localization Confidence High
Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
265-291KPTDTGNKKLKLKRKRSSAPKIPVIRDHydrophilic
NLS Segment(s)
PositionSequence
141-155ALGGKSRFARGERKR
239-285LRKKKAKAAAAAARDDSKPLKPTSGSKPTDTGNKKLKLKRKRSSAPK
Subcellular Location(s) nucl 21, cyto 4.5, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001357  BRCT_dom  
IPR036420  BRCT_dom_sf  
PROSITE View protein in PROSITE  
PS50172  BRCT  
Amino Acid Sequences MSSSSESDDSGMFADLTFFIHGQWAGRTYARVARLVKDNGGRVVKDVGDIDLSHAIVSGQLWSRQGTVSADLTIRAIIAANEDNRSEENENQNRVWLLPLEWLETSVEEGRKLSEVEHDFERTADVRAAERAKQIREETKALGGKSRFARGERKRYEREQAFKKEVALQAKMDKDGVTSGLDAFSGISPDPTSTSTNAVKPQPTAAVAFYKQDDFKPKSNSKASTSAGDNPDAALAAALRKKKAKAAAAAARDDSKPLKPTSGSKPTDTGNKKLKLKRKRSSAPKIPVIRDDSSDEDLPVVVVADKRRSSDSGPSVVEKKKREVIVVDTETDSDDVHQVPAKKKKTAPLREVSPEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.1
4 0.1
5 0.09
6 0.08
7 0.11
8 0.12
9 0.12
10 0.14
11 0.15
12 0.16
13 0.17
14 0.18
15 0.19
16 0.25
17 0.26
18 0.3
19 0.3
20 0.33
21 0.4
22 0.41
23 0.44
24 0.43
25 0.43
26 0.44
27 0.46
28 0.41
29 0.35
30 0.35
31 0.29
32 0.26
33 0.23
34 0.18
35 0.15
36 0.15
37 0.16
38 0.14
39 0.14
40 0.12
41 0.11
42 0.1
43 0.09
44 0.09
45 0.1
46 0.1
47 0.12
48 0.13
49 0.14
50 0.15
51 0.15
52 0.17
53 0.15
54 0.16
55 0.15
56 0.16
57 0.15
58 0.15
59 0.15
60 0.13
61 0.11
62 0.08
63 0.07
64 0.05
65 0.08
66 0.11
67 0.12
68 0.13
69 0.14
70 0.15
71 0.15
72 0.19
73 0.19
74 0.21
75 0.3
76 0.35
77 0.38
78 0.37
79 0.39
80 0.35
81 0.32
82 0.28
83 0.19
84 0.14
85 0.15
86 0.15
87 0.15
88 0.15
89 0.15
90 0.14
91 0.13
92 0.14
93 0.14
94 0.14
95 0.12
96 0.12
97 0.12
98 0.13
99 0.13
100 0.12
101 0.16
102 0.17
103 0.2
104 0.22
105 0.22
106 0.21
107 0.21
108 0.22
109 0.15
110 0.14
111 0.13
112 0.12
113 0.11
114 0.15
115 0.17
116 0.17
117 0.22
118 0.24
119 0.24
120 0.27
121 0.3
122 0.31
123 0.33
124 0.34
125 0.3
126 0.32
127 0.34
128 0.3
129 0.32
130 0.27
131 0.28
132 0.28
133 0.31
134 0.27
135 0.27
136 0.37
137 0.4
138 0.5
139 0.52
140 0.58
141 0.6
142 0.62
143 0.69
144 0.65
145 0.65
146 0.63
147 0.63
148 0.59
149 0.54
150 0.51
151 0.46
152 0.43
153 0.38
154 0.31
155 0.25
156 0.24
157 0.24
158 0.24
159 0.19
160 0.15
161 0.12
162 0.11
163 0.11
164 0.07
165 0.06
166 0.06
167 0.06
168 0.06
169 0.05
170 0.05
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.05
177 0.06
178 0.08
179 0.09
180 0.09
181 0.13
182 0.15
183 0.17
184 0.21
185 0.22
186 0.21
187 0.2
188 0.21
189 0.18
190 0.17
191 0.16
192 0.13
193 0.14
194 0.13
195 0.14
196 0.14
197 0.15
198 0.15
199 0.16
200 0.23
201 0.24
202 0.29
203 0.36
204 0.39
205 0.44
206 0.5
207 0.51
208 0.48
209 0.5
210 0.46
211 0.41
212 0.4
213 0.39
214 0.35
215 0.32
216 0.27
217 0.21
218 0.19
219 0.16
220 0.13
221 0.06
222 0.05
223 0.07
224 0.1
225 0.12
226 0.15
227 0.18
228 0.19
229 0.24
230 0.3
231 0.32
232 0.34
233 0.41
234 0.46
235 0.47
236 0.47
237 0.44
238 0.4
239 0.35
240 0.32
241 0.25
242 0.22
243 0.22
244 0.21
245 0.23
246 0.23
247 0.29
248 0.37
249 0.44
250 0.44
251 0.42
252 0.44
253 0.43
254 0.51
255 0.49
256 0.48
257 0.47
258 0.52
259 0.58
260 0.64
261 0.71
262 0.72
263 0.78
264 0.79
265 0.81
266 0.83
267 0.85
268 0.89
269 0.9
270 0.88
271 0.86
272 0.85
273 0.77
274 0.73
275 0.68
276 0.59
277 0.51
278 0.46
279 0.41
280 0.37
281 0.35
282 0.28
283 0.23
284 0.21
285 0.18
286 0.14
287 0.1
288 0.07
289 0.09
290 0.12
291 0.19
292 0.2
293 0.22
294 0.25
295 0.28
296 0.3
297 0.36
298 0.38
299 0.38
300 0.39
301 0.41
302 0.45
303 0.49
304 0.53
305 0.48
306 0.49
307 0.5
308 0.5
309 0.49
310 0.47
311 0.46
312 0.49
313 0.48
314 0.44
315 0.37
316 0.35
317 0.33
318 0.29
319 0.23
320 0.14
321 0.13
322 0.12
323 0.13
324 0.16
325 0.21
326 0.3
327 0.39
328 0.44
329 0.49
330 0.53
331 0.6
332 0.67
333 0.72
334 0.73
335 0.72
336 0.75