Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194SAA9

Protein Details
Accession A0A194SAA9   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
48-70DAAGWRQRRPRRARKPAAARGSVHydrophilic
74-101GQARAGSADRQRRRRRRGPEEPPGVRRABasic
NLS Segment(s)
PositionSequence
19-101PDRRRLGARHCGLRRRALDRERRERKRDGDAAGWRQRRPRRARKPAAARGSVPEAGQARAGSADRQRRRRRRGPEEPPGVRRA
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, cyto 6.5, mito 3, pero 2
Family & Domain DBs
Amino Acid Sequences TTLLYTSTLQHDPDQGRPPDRRRLGARHCGLRRRALDRERRERKRDGDAAGWRQRRPRRARKPAAARGSVPEAGQARAGSADRQRRRRRRGPEEPPGVRRALA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.43
4 0.49
5 0.53
6 0.57
7 0.59
8 0.59
9 0.57
10 0.63
11 0.65
12 0.68
13 0.69
14 0.68
15 0.69
16 0.7
17 0.67
18 0.65
19 0.61
20 0.57
21 0.59
22 0.57
23 0.61
24 0.63
25 0.71
26 0.74
27 0.77
28 0.77
29 0.75
30 0.71
31 0.69
32 0.64
33 0.56
34 0.52
35 0.5
36 0.53
37 0.54
38 0.53
39 0.46
40 0.49
41 0.51
42 0.54
43 0.57
44 0.61
45 0.64
46 0.72
47 0.8
48 0.82
49 0.87
50 0.87
51 0.85
52 0.76
53 0.66
54 0.58
55 0.53
56 0.44
57 0.33
58 0.28
59 0.22
60 0.19
61 0.2
62 0.16
63 0.12
64 0.13
65 0.14
66 0.13
67 0.19
68 0.29
69 0.37
70 0.47
71 0.58
72 0.67
73 0.76
74 0.82
75 0.86
76 0.87
77 0.9
78 0.89
79 0.89
80 0.9
81 0.88
82 0.84
83 0.77