Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194S535

Protein Details
Accession A0A194S535   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
16-40LWKMPWRLSKTRKMRQRLRLKAVDDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLGPFRASSPSMVGLLWKMPWRLSKTRKMRQRLRLKAVDDVIATVRASGVQTHSLTAALALPRESAMPPRDKYTTFSRKDPGYRKGIHKSPHFTKVTSRTNPEGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.16
4 0.16
5 0.15
6 0.18
7 0.24
8 0.3
9 0.38
10 0.45
11 0.53
12 0.6
13 0.68
14 0.75
15 0.79
16 0.82
17 0.82
18 0.86
19 0.85
20 0.83
21 0.81
22 0.74
23 0.69
24 0.6
25 0.51
26 0.4
27 0.31
28 0.23
29 0.17
30 0.15
31 0.09
32 0.08
33 0.06
34 0.06
35 0.06
36 0.06
37 0.08
38 0.09
39 0.09
40 0.09
41 0.09
42 0.08
43 0.08
44 0.08
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.07
51 0.07
52 0.1
53 0.14
54 0.19
55 0.2
56 0.24
57 0.26
58 0.27
59 0.31
60 0.36
61 0.43
62 0.41
63 0.44
64 0.45
65 0.48
66 0.56
67 0.6
68 0.57
69 0.55
70 0.58
71 0.61
72 0.65
73 0.67
74 0.66
75 0.67
76 0.68
77 0.67
78 0.7
79 0.65
80 0.57
81 0.59
82 0.61
83 0.63
84 0.61
85 0.61