Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194SCI8

Protein Details
Accession A0A194SCI8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
12-31VPTRRRPRLAAPPRARHRPGBasic
NLS Segment(s)
PositionSequence
15-32RRRPRLAAPPRARHRPGR
Subcellular Location(s) mito 27
Family & Domain DBs
Amino Acid Sequences RDAVRVLRHSLVPTRRRPRLAAPPRARHRPGRPLPPCDHLQEPHHCASTTCGQVQGELSGRRAPSGSRWRVCLEAKRPSNVEGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.64
3 0.65
4 0.66
5 0.66
6 0.68
7 0.7
8 0.7
9 0.7
10 0.74
11 0.78
12 0.83
13 0.78
14 0.75
15 0.73
16 0.73
17 0.7
18 0.71
19 0.69
20 0.67
21 0.67
22 0.63
23 0.57
24 0.5
25 0.45
26 0.37
27 0.35
28 0.34
29 0.34
30 0.31
31 0.3
32 0.27
33 0.24
34 0.25
35 0.25
36 0.22
37 0.18
38 0.19
39 0.17
40 0.18
41 0.18
42 0.17
43 0.16
44 0.15
45 0.16
46 0.17
47 0.17
48 0.18
49 0.18
50 0.16
51 0.21
52 0.31
53 0.39
54 0.38
55 0.42
56 0.44
57 0.49
58 0.54
59 0.54
60 0.51
61 0.52
62 0.54
63 0.57
64 0.57