Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194S2R4

Protein Details
Accession A0A194S2R4    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
53-80ECKRGMRHTERISRRKRFRGNEPTQFKVBasic
NLS Segment(s)
PositionSequence
64-71ISRRKRFR
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, cyto 7.5, mito 3, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018793  Cyt_c_oxidase_assmbl_Pet191  
Pfam View protein in Pfam  
PF10203  Pet191_N  
Amino Acid Sequences MSCQGIRAALADCILRSDCVLRSDPPRSPQECLKDHVDELPEECQLLRKSFFECKRGMRHTERISRRKRFRGNEPTQFKVPGKEGLGEGAGAKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.11
4 0.13
5 0.14
6 0.17
7 0.19
8 0.2
9 0.25
10 0.3
11 0.33
12 0.37
13 0.42
14 0.41
15 0.42
16 0.46
17 0.48
18 0.45
19 0.45
20 0.43
21 0.37
22 0.35
23 0.34
24 0.29
25 0.21
26 0.2
27 0.18
28 0.13
29 0.11
30 0.11
31 0.13
32 0.12
33 0.14
34 0.13
35 0.13
36 0.16
37 0.24
38 0.28
39 0.27
40 0.29
41 0.33
42 0.4
43 0.44
44 0.48
45 0.46
46 0.51
47 0.55
48 0.62
49 0.66
50 0.69
51 0.74
52 0.78
53 0.81
54 0.82
55 0.83
56 0.81
57 0.82
58 0.83
59 0.83
60 0.84
61 0.81
62 0.77
63 0.7
64 0.68
65 0.58
66 0.52
67 0.45
68 0.4
69 0.35
70 0.31
71 0.29
72 0.26
73 0.25
74 0.21