Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194S570

Protein Details
Accession A0A194S570    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
120-145LVTAVDARRRRRRSKGRRAGDGRCRGBasic
NLS Segment(s)
PositionSequence
58-100GPARARRSRRTAERRPAGRPGPRHPATAPLHRGAQGPVERAAR
126-139ARRRRRRSKGRRAG
Subcellular Location(s) extr 9, mito 8, cyto 6.5, cyto_nucl 5, nucl 2.5
Family & Domain DBs
Amino Acid Sequences LLWVVELVLDRFSLGSQHVLLRQVPHGQSRRRRPHLVLPERDPPYERLALVRLAPSLGPARARRSRRTAERRPAGRPGPRHPATAPLHRGAQGPVERAARQPDPQRPGDRLVGRRWQRLLVTAVDARRRRRRSKGRRAGDGRCRGGRCGSWPELERWAGGAVDARDAVWSGAAGREGGQGPEERGDGGQGGRGQAARGQGGQALGLVLPQICNKRLCKVQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.11
4 0.14
5 0.16
6 0.19
7 0.21
8 0.22
9 0.24
10 0.28
11 0.29
12 0.36
13 0.41
14 0.48
15 0.56
16 0.65
17 0.73
18 0.74
19 0.78
20 0.74
21 0.77
22 0.79
23 0.79
24 0.76
25 0.71
26 0.72
27 0.69
28 0.64
29 0.56
30 0.47
31 0.43
32 0.37
33 0.32
34 0.25
35 0.23
36 0.24
37 0.22
38 0.21
39 0.15
40 0.14
41 0.13
42 0.13
43 0.14
44 0.13
45 0.17
46 0.18
47 0.26
48 0.33
49 0.39
50 0.43
51 0.49
52 0.56
53 0.62
54 0.7
55 0.73
56 0.75
57 0.8
58 0.78
59 0.75
60 0.74
61 0.7
62 0.66
63 0.62
64 0.57
65 0.58
66 0.55
67 0.53
68 0.46
69 0.48
70 0.45
71 0.47
72 0.45
73 0.36
74 0.36
75 0.34
76 0.35
77 0.26
78 0.27
79 0.21
80 0.19
81 0.2
82 0.21
83 0.2
84 0.2
85 0.24
86 0.2
87 0.22
88 0.27
89 0.3
90 0.33
91 0.37
92 0.38
93 0.36
94 0.38
95 0.4
96 0.39
97 0.35
98 0.35
99 0.39
100 0.4
101 0.41
102 0.39
103 0.35
104 0.31
105 0.3
106 0.28
107 0.2
108 0.2
109 0.19
110 0.2
111 0.26
112 0.29
113 0.33
114 0.41
115 0.47
116 0.51
117 0.59
118 0.68
119 0.72
120 0.8
121 0.84
122 0.82
123 0.85
124 0.85
125 0.84
126 0.82
127 0.8
128 0.73
129 0.68
130 0.62
131 0.53
132 0.49
133 0.41
134 0.36
135 0.34
136 0.31
137 0.3
138 0.3
139 0.31
140 0.33
141 0.32
142 0.27
143 0.21
144 0.19
145 0.14
146 0.13
147 0.14
148 0.1
149 0.1
150 0.1
151 0.09
152 0.09
153 0.09
154 0.09
155 0.06
156 0.05
157 0.05
158 0.06
159 0.06
160 0.06
161 0.07
162 0.09
163 0.1
164 0.1
165 0.12
166 0.12
167 0.13
168 0.14
169 0.14
170 0.12
171 0.11
172 0.11
173 0.11
174 0.1
175 0.13
176 0.12
177 0.13
178 0.14
179 0.14
180 0.14
181 0.15
182 0.18
183 0.15
184 0.15
185 0.15
186 0.15
187 0.15
188 0.14
189 0.12
190 0.1
191 0.08
192 0.07
193 0.07
194 0.06
195 0.07
196 0.11
197 0.16
198 0.19
199 0.25
200 0.27
201 0.34