Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194SAZ9

Protein Details
Accession A0A194SAZ9    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSPKTTPKRKRGSPTKPKQPVAMFHydrophilic
NLS Segment(s)
PositionSequence
7-16PKRKRGSPTK
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MSPKTTPKRKRGSPTKPKQPVAMFVNYSAQDAKKLLNGVAPSGSTKKRREEEDAQRQRGDMSSSILLDDPASLPVLPLPFATGSHSSAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.91
4 0.85
5 0.81
6 0.73
7 0.69
8 0.63
9 0.57
10 0.47
11 0.38
12 0.4
13 0.33
14 0.31
15 0.24
16 0.19
17 0.15
18 0.15
19 0.14
20 0.12
21 0.12
22 0.12
23 0.13
24 0.13
25 0.12
26 0.12
27 0.11
28 0.1
29 0.13
30 0.17
31 0.21
32 0.24
33 0.3
34 0.33
35 0.36
36 0.42
37 0.48
38 0.55
39 0.61
40 0.67
41 0.64
42 0.6
43 0.57
44 0.5
45 0.41
46 0.33
47 0.22
48 0.16
49 0.14
50 0.14
51 0.15
52 0.14
53 0.13
54 0.11
55 0.1
56 0.07
57 0.07
58 0.08
59 0.07
60 0.07
61 0.09
62 0.09
63 0.09
64 0.09
65 0.1
66 0.1
67 0.11
68 0.15
69 0.16