Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194S879

Protein Details
Accession A0A194S879    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
26-60AKCFRFCRSKCSKNFKMKRNPRKLKWTKAFRKAAGHydrophilic
NLS Segment(s)
PositionSequence
41-59KMKRNPRKLKWTKAFRKAA
Subcellular Location(s) cyto_nucl 10.5, cyto 9.5, nucl 8.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR011017  TRASH_dom  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences VKIEPCYVCGSPCYPGHGTMFVRNDAKCFRFCRSKCSKNFKMKRNPRKLKWTKAFRKAAGKEMTVDSTLAFEKRRHVPVVYDRDLVQATVAGMKRIAEVKARRERAFFKARMAAAKDGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.28
4 0.3
5 0.3
6 0.32
7 0.34
8 0.32
9 0.34
10 0.32
11 0.33
12 0.33
13 0.33
14 0.31
15 0.31
16 0.34
17 0.41
18 0.41
19 0.48
20 0.53
21 0.6
22 0.65
23 0.72
24 0.75
25 0.76
26 0.84
27 0.85
28 0.85
29 0.87
30 0.88
31 0.9
32 0.9
33 0.86
34 0.88
35 0.87
36 0.87
37 0.85
38 0.85
39 0.83
40 0.83
41 0.82
42 0.75
43 0.76
44 0.67
45 0.65
46 0.56
47 0.47
48 0.39
49 0.34
50 0.31
51 0.21
52 0.2
53 0.12
54 0.1
55 0.1
56 0.09
57 0.1
58 0.1
59 0.14
60 0.2
61 0.23
62 0.24
63 0.24
64 0.28
65 0.36
66 0.44
67 0.42
68 0.38
69 0.35
70 0.35
71 0.35
72 0.29
73 0.2
74 0.12
75 0.09
76 0.12
77 0.12
78 0.11
79 0.11
80 0.11
81 0.13
82 0.14
83 0.16
84 0.19
85 0.24
86 0.33
87 0.43
88 0.5
89 0.5
90 0.53
91 0.56
92 0.57
93 0.62
94 0.54
95 0.5
96 0.51
97 0.51
98 0.53
99 0.53