Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194S8W3

Protein Details
Accession A0A194S8W3    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
333-370ANGPPPPRRRSSRSRSPGARRASPPPPRRRPVDDDVRMHydrophilic
NLS Segment(s)
PositionSequence
206-285AGGPPHGRGGPGGFGPRAGAGPGPGGAGYGPRGGAGGPGGGAPVHPARAGMLAGGAGGPRRGGAPGAADHGWGAEGGRRR
335-363GPPPPRRRSSRSRSPGARRASPPPPRRRP
Subcellular Location(s) mito 18, extr 4, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010516  SAP18  
IPR042534  SAP18_sf  
Pfam View protein in Pfam  
PF06487  SAP18  
Amino Acid Sequences MAPLPPPARSRPPRVSPSLLRVFARTGSHHPDSDYTVDRLPTTGDELALFCWPDSTLRELALLALDALPPVPQHLHHATRISLRLVYYDPDSTRFRSTDLANFTLREIATPPSSSSTSSAATTPARLDRTLAEAKYVVGDLVDLALLVPAAEPTALAPTAALGPAGAPAFGIRGAAAAHGPRGGAGPGAHGPAPGGRGNFAPLVGAGGPPHGRGGPGGFGPRAGAGPGPGGAGYGPRGGAGGPGGGAPVHPARAGMLAGGAGGPRRGGAPGAADHGWGAEGGRRRSDGPDGFGGGPRGAAGPYGGGGGRGPGGYDSRDGPRDRPPHVASSSTANGPPPPRRRSSRSRSPGARRASPPPPRRRPVDDDVRMRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.76
3 0.72
4 0.74
5 0.73
6 0.68
7 0.6
8 0.54
9 0.49
10 0.44
11 0.41
12 0.36
13 0.33
14 0.37
15 0.4
16 0.39
17 0.38
18 0.37
19 0.37
20 0.38
21 0.35
22 0.29
23 0.28
24 0.28
25 0.26
26 0.24
27 0.22
28 0.18
29 0.19
30 0.17
31 0.15
32 0.14
33 0.15
34 0.15
35 0.16
36 0.15
37 0.1
38 0.1
39 0.1
40 0.11
41 0.13
42 0.16
43 0.16
44 0.16
45 0.16
46 0.16
47 0.16
48 0.14
49 0.12
50 0.08
51 0.07
52 0.06
53 0.06
54 0.06
55 0.06
56 0.05
57 0.07
58 0.07
59 0.08
60 0.14
61 0.21
62 0.24
63 0.28
64 0.3
65 0.31
66 0.35
67 0.37
68 0.32
69 0.27
70 0.24
71 0.23
72 0.21
73 0.21
74 0.18
75 0.2
76 0.19
77 0.22
78 0.24
79 0.25
80 0.28
81 0.26
82 0.25
83 0.25
84 0.26
85 0.28
86 0.31
87 0.31
88 0.28
89 0.28
90 0.27
91 0.27
92 0.24
93 0.18
94 0.15
95 0.14
96 0.15
97 0.15
98 0.15
99 0.16
100 0.17
101 0.17
102 0.17
103 0.17
104 0.16
105 0.16
106 0.16
107 0.15
108 0.15
109 0.15
110 0.15
111 0.17
112 0.17
113 0.16
114 0.17
115 0.15
116 0.21
117 0.24
118 0.22
119 0.2
120 0.18
121 0.18
122 0.18
123 0.17
124 0.1
125 0.06
126 0.06
127 0.04
128 0.04
129 0.04
130 0.03
131 0.03
132 0.03
133 0.02
134 0.02
135 0.02
136 0.02
137 0.02
138 0.02
139 0.02
140 0.03
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.05
147 0.05
148 0.04
149 0.03
150 0.03
151 0.04
152 0.05
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.03
160 0.03
161 0.04
162 0.04
163 0.05
164 0.04
165 0.05
166 0.05
167 0.05
168 0.05
169 0.05
170 0.05
171 0.05
172 0.05
173 0.06
174 0.07
175 0.08
176 0.07
177 0.07
178 0.07
179 0.07
180 0.09
181 0.09
182 0.08
183 0.08
184 0.09
185 0.1
186 0.1
187 0.1
188 0.07
189 0.06
190 0.07
191 0.06
192 0.06
193 0.05
194 0.06
195 0.06
196 0.06
197 0.07
198 0.06
199 0.06
200 0.06
201 0.07
202 0.07
203 0.08
204 0.1
205 0.09
206 0.09
207 0.09
208 0.1
209 0.09
210 0.07
211 0.06
212 0.05
213 0.06
214 0.06
215 0.06
216 0.05
217 0.05
218 0.04
219 0.05
220 0.06
221 0.06
222 0.05
223 0.05
224 0.05
225 0.05
226 0.06
227 0.05
228 0.04
229 0.04
230 0.04
231 0.04
232 0.04
233 0.04
234 0.06
235 0.06
236 0.07
237 0.07
238 0.07
239 0.07
240 0.08
241 0.09
242 0.06
243 0.06
244 0.05
245 0.05
246 0.05
247 0.05
248 0.04
249 0.04
250 0.04
251 0.04
252 0.05
253 0.05
254 0.06
255 0.06
256 0.08
257 0.09
258 0.13
259 0.13
260 0.13
261 0.12
262 0.12
263 0.11
264 0.08
265 0.08
266 0.08
267 0.14
268 0.16
269 0.18
270 0.19
271 0.2
272 0.23
273 0.3
274 0.29
275 0.27
276 0.28
277 0.3
278 0.29
279 0.3
280 0.29
281 0.21
282 0.18
283 0.14
284 0.13
285 0.09
286 0.08
287 0.07
288 0.05
289 0.06
290 0.07
291 0.06
292 0.06
293 0.06
294 0.07
295 0.07
296 0.07
297 0.07
298 0.07
299 0.09
300 0.1
301 0.12
302 0.15
303 0.19
304 0.25
305 0.27
306 0.28
307 0.36
308 0.41
309 0.43
310 0.48
311 0.47
312 0.48
313 0.49
314 0.49
315 0.4
316 0.41
317 0.41
318 0.35
319 0.33
320 0.27
321 0.3
322 0.34
323 0.42
324 0.44
325 0.48
326 0.54
327 0.61
328 0.67
329 0.73
330 0.77
331 0.78
332 0.79
333 0.82
334 0.84
335 0.86
336 0.86
337 0.84
338 0.83
339 0.76
340 0.75
341 0.75
342 0.75
343 0.76
344 0.78
345 0.81
346 0.79
347 0.82
348 0.82
349 0.8
350 0.8
351 0.81
352 0.79