Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P9IT75

Protein Details
Accession A0A0P9IT75   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
96-126GLAEKKERTGRKLRKERKKCFRGVAKVTKSABasic
NLS Segment(s)
PositionSequence
89-129RHRLIKFGLAEKKERTGRKLRKERKKCFRGVAKVTKSAGKK
Subcellular Location(s) mito 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MDPNGAVTIRTRKFLTNRLLQRKQMVVDVLHPTRANVSKDELRDKLAAMYKAPKDQVIVFGFRTQFGGGKSTGFALIYDSKEALKFEPRHRLIKFGLAEKKERTGRKLRKERKKCFRGVAKVTKSAGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.5
4 0.59
5 0.66
6 0.7
7 0.68
8 0.68
9 0.63
10 0.56
11 0.5
12 0.42
13 0.32
14 0.3
15 0.34
16 0.29
17 0.28
18 0.27
19 0.24
20 0.26
21 0.3
22 0.27
23 0.21
24 0.26
25 0.28
26 0.31
27 0.37
28 0.33
29 0.31
30 0.3
31 0.28
32 0.27
33 0.27
34 0.24
35 0.2
36 0.25
37 0.24
38 0.27
39 0.27
40 0.23
41 0.19
42 0.19
43 0.23
44 0.19
45 0.19
46 0.16
47 0.18
48 0.18
49 0.17
50 0.17
51 0.12
52 0.11
53 0.1
54 0.12
55 0.09
56 0.09
57 0.09
58 0.09
59 0.09
60 0.07
61 0.07
62 0.08
63 0.1
64 0.11
65 0.11
66 0.11
67 0.11
68 0.12
69 0.13
70 0.11
71 0.17
72 0.22
73 0.26
74 0.37
75 0.4
76 0.47
77 0.47
78 0.5
79 0.43
80 0.46
81 0.43
82 0.41
83 0.44
84 0.4
85 0.44
86 0.42
87 0.48
88 0.48
89 0.48
90 0.48
91 0.51
92 0.58
93 0.65
94 0.74
95 0.77
96 0.81
97 0.89
98 0.93
99 0.93
100 0.93
101 0.9
102 0.89
103 0.88
104 0.88
105 0.87
106 0.87
107 0.82
108 0.79
109 0.74