Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194S8T1

Protein Details
Accession A0A194S8T1    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
68-94STETDDTQSHKKKKHKKAHKPHLSSLVHydrophilic
NLS Segment(s)
PositionSequence
78-88KKKKHKKAHKP
Subcellular Location(s) nucl 17.5, cyto_nucl 12, mito 6
Family & Domain DBs
Amino Acid Sequences MAKRGRILDSPAAPTSFAPRDPAPTPPPPPAATAPKHNKPDSDTTHSRPVAIAPAPPSSSFNHPPAASTETDDTQSHKKKKHKKAHKPHLSSLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.26
4 0.22
5 0.22
6 0.21
7 0.25
8 0.26
9 0.31
10 0.31
11 0.34
12 0.37
13 0.37
14 0.4
15 0.36
16 0.38
17 0.37
18 0.38
19 0.34
20 0.41
21 0.45
22 0.49
23 0.54
24 0.51
25 0.48
26 0.45
27 0.5
28 0.47
29 0.47
30 0.44
31 0.42
32 0.49
33 0.47
34 0.43
35 0.35
36 0.29
37 0.24
38 0.2
39 0.18
40 0.12
41 0.14
42 0.14
43 0.15
44 0.16
45 0.16
46 0.21
47 0.24
48 0.24
49 0.26
50 0.25
51 0.26
52 0.27
53 0.28
54 0.22
55 0.21
56 0.22
57 0.19
58 0.21
59 0.21
60 0.21
61 0.27
62 0.36
63 0.41
64 0.46
65 0.55
66 0.64
67 0.74
68 0.82
69 0.84
70 0.86
71 0.91
72 0.94
73 0.95
74 0.93