Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P9GXJ8

Protein Details
Accession A0A0P9GXJ8    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
318-344PAAPRRQFWRLWRRRAKSRPSDRAAGSHydrophilic
427-452RCPLCQRDLHAPKKRGRQALRRGGGGBasic
NLS Segment(s)
PositionSequence
319-337AAPRRQFWRLWRRRAKSRP
439-448KKRGRQALRR
Subcellular Location(s) plas 20, mito 2, E.R. 2, nucl 1, cyto 1, cyto_nucl 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
IPR024766  Znf_RING_H2  
Gene Ontology GO:0016020  C:membrane  
GO:0008270  F:zinc ion binding  
GO:0016567  P:protein ubiquitination  
Pfam View protein in Pfam  
PF12678  zf-rbx1  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
Amino Acid Sequences MASAPPQLTRTSSEPPTLPPLALSPPSSPVLTSSPHTFPPRQDDVDYDGNEIGVAMGGDTVPPAATVRLSVLRRMWAATGELQGLRRARLAFFGIVGLAQVVAFTVICATSYHDQCDVPLGPYLVMVIVRIVCAFPPYFWLTISPPRPDRRNPDAVRAALAQSRHVGSLAVDYRVRRLADLISIYSVVVFVAGNWWVISSTSCPADSPTLYRGAVAALVFSWLYVAEILVWATLVIFFLPFLLIGVRWFGMGQKKNEVGPLKKEDVASLPQRVFLGIIPDEGPPPSAASASPALADPASPTPSPATPNPPPSPSPAPPAAPRRQFWRLWRRRAKSRPSDRAAGSGAQSSGSAGVADGERAPLPEGVEGLRLPESQAACAICLCEYEPPPLLSSPEAATWQPERLILLPCAHTFHTECLGDWLAVSGRCPLCQRDLHAPKKRGRQALRRGGGGGSDGDVREVASEIGAPTADERV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.43
4 0.4
5 0.35
6 0.28
7 0.28
8 0.28
9 0.3
10 0.29
11 0.23
12 0.26
13 0.28
14 0.27
15 0.24
16 0.22
17 0.22
18 0.22
19 0.24
20 0.26
21 0.26
22 0.33
23 0.39
24 0.39
25 0.41
26 0.47
27 0.5
28 0.48
29 0.47
30 0.44
31 0.44
32 0.48
33 0.44
34 0.38
35 0.3
36 0.26
37 0.25
38 0.21
39 0.15
40 0.07
41 0.06
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.05
51 0.06
52 0.06
53 0.07
54 0.1
55 0.17
56 0.18
57 0.22
58 0.23
59 0.26
60 0.27
61 0.28
62 0.25
63 0.2
64 0.21
65 0.2
66 0.2
67 0.18
68 0.19
69 0.19
70 0.22
71 0.22
72 0.21
73 0.21
74 0.21
75 0.19
76 0.2
77 0.22
78 0.18
79 0.17
80 0.16
81 0.13
82 0.12
83 0.11
84 0.08
85 0.05
86 0.04
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.04
95 0.05
96 0.09
97 0.15
98 0.16
99 0.19
100 0.2
101 0.2
102 0.2
103 0.24
104 0.21
105 0.17
106 0.17
107 0.16
108 0.14
109 0.14
110 0.14
111 0.09
112 0.08
113 0.07
114 0.06
115 0.05
116 0.05
117 0.06
118 0.06
119 0.05
120 0.07
121 0.08
122 0.07
123 0.11
124 0.13
125 0.14
126 0.14
127 0.16
128 0.18
129 0.26
130 0.3
131 0.31
132 0.35
133 0.41
134 0.46
135 0.5
136 0.56
137 0.55
138 0.62
139 0.58
140 0.61
141 0.61
142 0.56
143 0.51
144 0.44
145 0.37
146 0.29
147 0.27
148 0.19
149 0.15
150 0.15
151 0.13
152 0.12
153 0.11
154 0.09
155 0.14
156 0.15
157 0.15
158 0.16
159 0.16
160 0.18
161 0.21
162 0.21
163 0.15
164 0.15
165 0.14
166 0.15
167 0.16
168 0.14
169 0.11
170 0.11
171 0.11
172 0.1
173 0.09
174 0.05
175 0.04
176 0.04
177 0.03
178 0.04
179 0.04
180 0.05
181 0.04
182 0.05
183 0.04
184 0.05
185 0.06
186 0.06
187 0.07
188 0.08
189 0.09
190 0.09
191 0.1
192 0.12
193 0.12
194 0.12
195 0.12
196 0.14
197 0.14
198 0.14
199 0.13
200 0.11
201 0.11
202 0.09
203 0.07
204 0.04
205 0.05
206 0.05
207 0.04
208 0.04
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.03
217 0.03
218 0.02
219 0.02
220 0.03
221 0.02
222 0.02
223 0.02
224 0.02
225 0.02
226 0.03
227 0.02
228 0.03
229 0.03
230 0.03
231 0.03
232 0.04
233 0.04
234 0.04
235 0.04
236 0.06
237 0.13
238 0.18
239 0.19
240 0.23
241 0.24
242 0.25
243 0.29
244 0.31
245 0.27
246 0.28
247 0.32
248 0.3
249 0.31
250 0.31
251 0.27
252 0.26
253 0.28
254 0.25
255 0.24
256 0.21
257 0.2
258 0.2
259 0.19
260 0.17
261 0.13
262 0.13
263 0.09
264 0.1
265 0.1
266 0.1
267 0.11
268 0.1
269 0.11
270 0.07
271 0.07
272 0.07
273 0.06
274 0.06
275 0.08
276 0.09
277 0.09
278 0.09
279 0.08
280 0.08
281 0.08
282 0.08
283 0.07
284 0.08
285 0.11
286 0.1
287 0.11
288 0.12
289 0.14
290 0.17
291 0.18
292 0.23
293 0.25
294 0.33
295 0.35
296 0.37
297 0.37
298 0.39
299 0.44
300 0.39
301 0.39
302 0.35
303 0.35
304 0.38
305 0.45
306 0.47
307 0.46
308 0.46
309 0.48
310 0.51
311 0.53
312 0.56
313 0.6
314 0.61
315 0.67
316 0.76
317 0.76
318 0.81
319 0.86
320 0.86
321 0.86
322 0.87
323 0.86
324 0.81
325 0.8
326 0.7
327 0.65
328 0.56
329 0.47
330 0.37
331 0.28
332 0.23
333 0.17
334 0.15
335 0.12
336 0.1
337 0.08
338 0.07
339 0.05
340 0.06
341 0.05
342 0.06
343 0.06
344 0.07
345 0.07
346 0.08
347 0.09
348 0.09
349 0.09
350 0.09
351 0.1
352 0.09
353 0.11
354 0.1
355 0.11
356 0.11
357 0.11
358 0.11
359 0.14
360 0.14
361 0.13
362 0.16
363 0.14
364 0.13
365 0.14
366 0.13
367 0.09
368 0.1
369 0.1
370 0.12
371 0.13
372 0.16
373 0.19
374 0.19
375 0.21
376 0.21
377 0.22
378 0.18
379 0.19
380 0.17
381 0.15
382 0.17
383 0.15
384 0.18
385 0.18
386 0.19
387 0.18
388 0.17
389 0.18
390 0.18
391 0.22
392 0.2
393 0.22
394 0.23
395 0.23
396 0.25
397 0.24
398 0.25
399 0.23
400 0.24
401 0.26
402 0.23
403 0.23
404 0.24
405 0.25
406 0.22
407 0.2
408 0.18
409 0.15
410 0.15
411 0.15
412 0.19
413 0.18
414 0.21
415 0.24
416 0.25
417 0.29
418 0.32
419 0.37
420 0.41
421 0.5
422 0.58
423 0.66
424 0.71
425 0.73
426 0.8
427 0.83
428 0.82
429 0.81
430 0.81
431 0.82
432 0.85
433 0.82
434 0.74
435 0.67
436 0.58
437 0.49
438 0.4
439 0.3
440 0.2
441 0.18
442 0.15
443 0.14
444 0.13
445 0.12
446 0.11
447 0.11
448 0.1
449 0.07
450 0.08
451 0.08
452 0.09
453 0.09
454 0.08