Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194SDG5

Protein Details
Accession A0A194SDG5    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-43RPPSPRRLRHLLVRRRRLRPPRVPARPLSBasic
NLS Segment(s)
PositionSequence
11-88SHHARPPSPRRLRHLLVRRRRLRPPRVPARPLSQRRPAVGHRRALWRRHLSALGPENRQSRGASRERDSPHSPRSTRR
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
Amino Acid Sequences TLSTSHRAPPSHHARPPSPRRLRHLLVRRRRLRPPRVPARPLSQRRPAVGHRRALWRRHLSALGPENRQSRGASRERDSPHSPRSTRRRTFRFPALYSRSLSSPARSLSRPPCLSVPLRNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.67
3 0.74
4 0.74
5 0.74
6 0.72
7 0.75
8 0.77
9 0.75
10 0.74
11 0.75
12 0.74
13 0.75
14 0.79
15 0.81
16 0.79
17 0.84
18 0.84
19 0.84
20 0.83
21 0.83
22 0.83
23 0.84
24 0.82
25 0.76
26 0.74
27 0.74
28 0.72
29 0.68
30 0.66
31 0.6
32 0.57
33 0.58
34 0.56
35 0.56
36 0.54
37 0.52
38 0.47
39 0.54
40 0.57
41 0.56
42 0.57
43 0.53
44 0.49
45 0.46
46 0.43
47 0.34
48 0.35
49 0.38
50 0.33
51 0.29
52 0.3
53 0.3
54 0.3
55 0.31
56 0.25
57 0.21
58 0.24
59 0.29
60 0.3
61 0.31
62 0.38
63 0.4
64 0.46
65 0.48
66 0.47
67 0.48
68 0.51
69 0.5
70 0.52
71 0.59
72 0.64
73 0.67
74 0.71
75 0.73
76 0.72
77 0.78
78 0.78
79 0.76
80 0.69
81 0.7
82 0.67
83 0.62
84 0.56
85 0.51
86 0.42
87 0.38
88 0.36
89 0.29
90 0.27
91 0.27
92 0.3
93 0.29
94 0.36
95 0.39
96 0.48
97 0.47
98 0.46
99 0.45
100 0.47
101 0.5