Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194SCV4

Protein Details
Accession A0A194SCV4    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSKSKNHTNHNQNKKAHKNGLKKPASHydrophilic
NLS Segment(s)
PositionSequence
15-24KAHKNGLKKP
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MSKSKNHTNHNQNKKAHKNGLKKPASTRERYANQRGVDPKFRRNARYASQGTQKVVAAERAAKAASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.8
5 0.8
6 0.8
7 0.83
8 0.78
9 0.71
10 0.69
11 0.69
12 0.66
13 0.61
14 0.56
15 0.53
16 0.55
17 0.59
18 0.58
19 0.54
20 0.48
21 0.48
22 0.49
23 0.44
24 0.47
25 0.44
26 0.44
27 0.46
28 0.5
29 0.49
30 0.48
31 0.5
32 0.46
33 0.52
34 0.5
35 0.47
36 0.52
37 0.52
38 0.49
39 0.45
40 0.4
41 0.33
42 0.31
43 0.27
44 0.21
45 0.21
46 0.2
47 0.2