Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194S2R0

Protein Details
Accession A0A194S2R0    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-29AAPANKSSAKGKKKWSKGKVKDKAQNAVIHydrophilic
NLS Segment(s)
PositionSequence
7-22SSAKGKKKWSKGKVKD
Subcellular Location(s) nucl 15, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences AAPANKSSAKGKKKWSKGKVKDKAQNAVICDKPTFDRIMKEVPTFKMISQSVLIERMKINGSLARVAIAHLEKEGLIKPVIHHRAQLVYTRTSADVDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.85
4 0.87
5 0.92
6 0.91
7 0.91
8 0.89
9 0.84
10 0.81
11 0.76
12 0.68
13 0.6
14 0.56
15 0.48
16 0.41
17 0.35
18 0.28
19 0.24
20 0.23
21 0.23
22 0.18
23 0.18
24 0.19
25 0.23
26 0.24
27 0.25
28 0.26
29 0.24
30 0.25
31 0.24
32 0.22
33 0.23
34 0.21
35 0.19
36 0.17
37 0.16
38 0.14
39 0.17
40 0.17
41 0.12
42 0.12
43 0.13
44 0.13
45 0.12
46 0.13
47 0.1
48 0.12
49 0.12
50 0.12
51 0.1
52 0.1
53 0.1
54 0.12
55 0.1
56 0.1
57 0.09
58 0.09
59 0.08
60 0.1
61 0.11
62 0.1
63 0.1
64 0.11
65 0.12
66 0.22
67 0.28
68 0.27
69 0.28
70 0.28
71 0.32
72 0.33
73 0.38
74 0.32
75 0.29
76 0.3
77 0.3
78 0.29