Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0N8PZQ1

Protein Details
Accession A0A0N8PZQ1    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
155-174SGSGTKRRARKPSQRSPPLDHydrophilic
NLS Segment(s)
PositionSequence
161-165RRARK
Subcellular Location(s) nucl 9.5, mito 9, cyto_nucl 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MADAPNPKPVRSSTNSKGRQNSPPPYRSHAETSMEDFVNEFWQHAMNVAEHHEDDFKHQALPLARIKKVAKMDPEVQQQMISSEVTVLFEKACQVFIQEVTARAHLVSLAARRRTLSRADVAQAVSRSDMFDFLIDIVPRNEQRAAASTLDAVASGSGTKRRARKPSQRSPPLDGNGAGLAVGTEGLDGGAGSGGEDDIGEPGGKRMRFFEGEGMVDPQQQGAGHGQGVYSMPVDVATAQAQADAATFYMQPDGTPAFSAEGDLPWPPSFGFPAARTVPDLQAYYQQPQPGGSGTDAGQQGAGQVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.65
3 0.7
4 0.75
5 0.72
6 0.76
7 0.77
8 0.78
9 0.77
10 0.74
11 0.72
12 0.7
13 0.68
14 0.63
15 0.6
16 0.55
17 0.5
18 0.46
19 0.46
20 0.45
21 0.4
22 0.36
23 0.29
24 0.24
25 0.24
26 0.21
27 0.17
28 0.12
29 0.13
30 0.13
31 0.14
32 0.15
33 0.1
34 0.12
35 0.14
36 0.15
37 0.14
38 0.16
39 0.16
40 0.15
41 0.19
42 0.22
43 0.2
44 0.19
45 0.19
46 0.23
47 0.23
48 0.29
49 0.32
50 0.33
51 0.33
52 0.39
53 0.39
54 0.41
55 0.44
56 0.44
57 0.41
58 0.41
59 0.45
60 0.47
61 0.53
62 0.49
63 0.43
64 0.38
65 0.33
66 0.27
67 0.24
68 0.16
69 0.09
70 0.08
71 0.07
72 0.09
73 0.09
74 0.08
75 0.07
76 0.07
77 0.09
78 0.09
79 0.09
80 0.08
81 0.09
82 0.09
83 0.1
84 0.13
85 0.12
86 0.14
87 0.15
88 0.15
89 0.14
90 0.13
91 0.13
92 0.09
93 0.09
94 0.09
95 0.12
96 0.18
97 0.19
98 0.2
99 0.21
100 0.23
101 0.25
102 0.26
103 0.24
104 0.22
105 0.23
106 0.24
107 0.25
108 0.24
109 0.23
110 0.2
111 0.17
112 0.14
113 0.12
114 0.11
115 0.09
116 0.09
117 0.07
118 0.06
119 0.06
120 0.06
121 0.08
122 0.07
123 0.08
124 0.08
125 0.1
126 0.1
127 0.12
128 0.12
129 0.1
130 0.11
131 0.13
132 0.15
133 0.13
134 0.13
135 0.11
136 0.11
137 0.11
138 0.1
139 0.06
140 0.04
141 0.03
142 0.03
143 0.04
144 0.06
145 0.09
146 0.13
147 0.2
148 0.27
149 0.36
150 0.45
151 0.55
152 0.63
153 0.72
154 0.78
155 0.81
156 0.79
157 0.76
158 0.74
159 0.65
160 0.56
161 0.46
162 0.36
163 0.26
164 0.22
165 0.15
166 0.08
167 0.06
168 0.04
169 0.04
170 0.02
171 0.02
172 0.02
173 0.02
174 0.02
175 0.02
176 0.02
177 0.02
178 0.02
179 0.02
180 0.02
181 0.02
182 0.02
183 0.03
184 0.03
185 0.03
186 0.04
187 0.04
188 0.04
189 0.06
190 0.11
191 0.11
192 0.12
193 0.14
194 0.18
195 0.2
196 0.21
197 0.23
198 0.21
199 0.22
200 0.23
201 0.23
202 0.19
203 0.18
204 0.17
205 0.12
206 0.11
207 0.1
208 0.1
209 0.09
210 0.1
211 0.09
212 0.09
213 0.09
214 0.09
215 0.09
216 0.09
217 0.07
218 0.06
219 0.06
220 0.06
221 0.06
222 0.05
223 0.06
224 0.06
225 0.06
226 0.06
227 0.06
228 0.06
229 0.06
230 0.06
231 0.05
232 0.05
233 0.06
234 0.06
235 0.06
236 0.08
237 0.08
238 0.07
239 0.1
240 0.11
241 0.1
242 0.11
243 0.11
244 0.11
245 0.11
246 0.13
247 0.11
248 0.1
249 0.11
250 0.11
251 0.13
252 0.12
253 0.13
254 0.12
255 0.12
256 0.14
257 0.15
258 0.19
259 0.17
260 0.24
261 0.25
262 0.26
263 0.28
264 0.29
265 0.29
266 0.28
267 0.28
268 0.23
269 0.29
270 0.31
271 0.31
272 0.32
273 0.31
274 0.29
275 0.28
276 0.28
277 0.23
278 0.22
279 0.19
280 0.18
281 0.16
282 0.22
283 0.21
284 0.2
285 0.18
286 0.15