Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0P9GK75

Protein Details
Accession A0A0P9GK75    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
80-99HPLHDRPRHRYRPRGAHPLLBasic
143-163VPRPRLCRRLHPVRRDRLRSPBasic
NLS Segment(s)
PositionSequence
87-96RHRYRPRGAH
214-242RRPSRFGPLPPWRRAPSPSPPPRRSTRAG
Subcellular Location(s) mito 23, extr 4
Family & Domain DBs
Amino Acid Sequences LSRTVRPVLCLCYSLRTRTPTPQALSRNAFPRLPPRPRARVGLQRRLPRSLGQDHQGRHGVAAGAEERHDPQRLRLVVEHPLHDRPRHRYRPRGAHPLLLGRHAVRRPLPRLHPVDCRHRRVLGNRQHQGLHGRRLVVARQGVPRPRLCRRLHPVRRDRLRSPVAHRQQGDPAGAQEGGGGPLLSGSTCRSLPFCIFRRRRDEAPHLWRLDSTRRPSRFGPLPPWRRAPSPSPPPRRSTRAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.4
4 0.42
5 0.49
6 0.56
7 0.55
8 0.57
9 0.58
10 0.59
11 0.61
12 0.62
13 0.59
14 0.57
15 0.53
16 0.49
17 0.44
18 0.48
19 0.5
20 0.53
21 0.56
22 0.58
23 0.63
24 0.66
25 0.7
26 0.68
27 0.68
28 0.7
29 0.72
30 0.71
31 0.71
32 0.72
33 0.69
34 0.63
35 0.57
36 0.54
37 0.5
38 0.47
39 0.44
40 0.46
41 0.43
42 0.46
43 0.46
44 0.39
45 0.32
46 0.29
47 0.22
48 0.16
49 0.17
50 0.13
51 0.1
52 0.11
53 0.11
54 0.12
55 0.14
56 0.17
57 0.16
58 0.18
59 0.25
60 0.26
61 0.28
62 0.28
63 0.28
64 0.33
65 0.35
66 0.35
67 0.29
68 0.34
69 0.34
70 0.36
71 0.39
72 0.39
73 0.48
74 0.56
75 0.6
76 0.63
77 0.7
78 0.76
79 0.78
80 0.8
81 0.71
82 0.64
83 0.59
84 0.56
85 0.47
86 0.38
87 0.32
88 0.22
89 0.25
90 0.22
91 0.23
92 0.22
93 0.27
94 0.3
95 0.35
96 0.38
97 0.41
98 0.45
99 0.46
100 0.49
101 0.48
102 0.55
103 0.56
104 0.58
105 0.52
106 0.51
107 0.51
108 0.49
109 0.54
110 0.53
111 0.55
112 0.53
113 0.52
114 0.49
115 0.47
116 0.48
117 0.43
118 0.38
119 0.3
120 0.28
121 0.27
122 0.28
123 0.28
124 0.24
125 0.22
126 0.19
127 0.22
128 0.26
129 0.29
130 0.32
131 0.35
132 0.37
133 0.42
134 0.48
135 0.47
136 0.52
137 0.56
138 0.64
139 0.68
140 0.73
141 0.76
142 0.77
143 0.84
144 0.81
145 0.74
146 0.72
147 0.69
148 0.64
149 0.62
150 0.63
151 0.61
152 0.61
153 0.59
154 0.52
155 0.51
156 0.48
157 0.42
158 0.32
159 0.25
160 0.2
161 0.18
162 0.16
163 0.11
164 0.09
165 0.08
166 0.07
167 0.06
168 0.04
169 0.04
170 0.05
171 0.04
172 0.05
173 0.06
174 0.08
175 0.09
176 0.1
177 0.11
178 0.14
179 0.18
180 0.26
181 0.32
182 0.4
183 0.47
184 0.54
185 0.61
186 0.65
187 0.67
188 0.68
189 0.69
190 0.69
191 0.71
192 0.72
193 0.66
194 0.6
195 0.55
196 0.51
197 0.52
198 0.5
199 0.49
200 0.51
201 0.52
202 0.56
203 0.56
204 0.6
205 0.59
206 0.57
207 0.59
208 0.6
209 0.66
210 0.68
211 0.74
212 0.69
213 0.65
214 0.64
215 0.61
216 0.6
217 0.63
218 0.67
219 0.7
220 0.71
221 0.74
222 0.77