Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194S4A1

Protein Details
Accession A0A194S4A1   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
78-99KNVPHRLRVRLHRKRNDNEDAPBasic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 7, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000054  Ribosomal_L31e  
IPR023621  Ribosomal_L31e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01198  Ribosomal_L31e  
CDD cd00463  Ribosomal_L31e  
Amino Acid Sequences MARGQKTNAERKTRSALTDVVAREYTIHLHTKVHGQGFKHRAPSAVKAVRIFAQKAMGTKKVLLEPSVNEAIWGKGIKNVPHRLRVRLHRKRNDNEDAPADEKLYTQVSVVPTTDFKGLNTTVVDAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.49
3 0.42
4 0.36
5 0.39
6 0.34
7 0.29
8 0.26
9 0.23
10 0.21
11 0.19
12 0.19
13 0.16
14 0.18
15 0.16
16 0.16
17 0.18
18 0.23
19 0.26
20 0.28
21 0.28
22 0.27
23 0.35
24 0.41
25 0.43
26 0.42
27 0.38
28 0.37
29 0.37
30 0.4
31 0.4
32 0.38
33 0.36
34 0.32
35 0.33
36 0.33
37 0.33
38 0.29
39 0.2
40 0.2
41 0.18
42 0.21
43 0.22
44 0.21
45 0.19
46 0.2
47 0.2
48 0.19
49 0.19
50 0.17
51 0.15
52 0.13
53 0.16
54 0.17
55 0.15
56 0.13
57 0.12
58 0.11
59 0.12
60 0.11
61 0.07
62 0.1
63 0.13
64 0.17
65 0.24
66 0.33
67 0.35
68 0.44
69 0.47
70 0.48
71 0.53
72 0.59
73 0.63
74 0.64
75 0.72
76 0.72
77 0.79
78 0.82
79 0.83
80 0.81
81 0.74
82 0.68
83 0.61
84 0.56
85 0.48
86 0.41
87 0.33
88 0.24
89 0.21
90 0.19
91 0.16
92 0.12
93 0.1
94 0.13
95 0.14
96 0.16
97 0.16
98 0.16
99 0.15
100 0.17
101 0.2
102 0.17
103 0.16
104 0.19
105 0.19
106 0.2
107 0.2
108 0.19