Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0P9FAK1

Protein Details
Accession A0A0P9FAK1    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
62-83AEDYDRKTKKRRRPFETVQGLAHydrophilic
NLS Segment(s)
PositionSequence
68-74KTKKRRR
Subcellular Location(s) nucl 16.5, cyto_nucl 10.833, mito 5.5, cyto_mito 5.333, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029033  His_PPase_superfam  
Amino Acid Sequences MAALAADPFRPHRHKNTVLLIRHGEKKRDGSVGLNEAGKRRAKCLRKLLGAQGEHNVGLILAEDYDRKTKKRRRPFETVQGLAKDLGLKVDVECEVDDPKCVRRKIDQYAREGGTGDVVVCWKHSMLHKIAHELGAKTRPYPDERYDIMWTLRNGRVVKKESERCPGLDPQHPRKHDGDLEIDATSVIDDDDEEEEEEGSAWDEYDVETSAGQWQLGGLNELD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.64
3 0.71
4 0.72
5 0.69
6 0.69
7 0.66
8 0.61
9 0.64
10 0.61
11 0.55
12 0.51
13 0.53
14 0.51
15 0.49
16 0.45
17 0.4
18 0.41
19 0.4
20 0.37
21 0.35
22 0.32
23 0.31
24 0.35
25 0.36
26 0.31
27 0.32
28 0.39
29 0.43
30 0.51
31 0.59
32 0.62
33 0.63
34 0.67
35 0.69
36 0.68
37 0.62
38 0.55
39 0.47
40 0.4
41 0.33
42 0.28
43 0.2
44 0.11
45 0.09
46 0.08
47 0.05
48 0.04
49 0.04
50 0.05
51 0.07
52 0.14
53 0.16
54 0.19
55 0.29
56 0.38
57 0.49
58 0.59
59 0.68
60 0.69
61 0.77
62 0.82
63 0.83
64 0.83
65 0.75
66 0.68
67 0.58
68 0.51
69 0.41
70 0.33
71 0.23
72 0.14
73 0.11
74 0.08
75 0.07
76 0.06
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.09
83 0.09
84 0.1
85 0.1
86 0.15
87 0.21
88 0.21
89 0.23
90 0.27
91 0.34
92 0.43
93 0.51
94 0.51
95 0.49
96 0.54
97 0.53
98 0.46
99 0.4
100 0.3
101 0.21
102 0.16
103 0.11
104 0.06
105 0.05
106 0.05
107 0.04
108 0.05
109 0.04
110 0.07
111 0.09
112 0.13
113 0.16
114 0.21
115 0.22
116 0.25
117 0.25
118 0.26
119 0.25
120 0.22
121 0.22
122 0.22
123 0.22
124 0.19
125 0.21
126 0.21
127 0.24
128 0.29
129 0.29
130 0.29
131 0.31
132 0.34
133 0.33
134 0.32
135 0.3
136 0.28
137 0.26
138 0.26
139 0.26
140 0.28
141 0.27
142 0.3
143 0.35
144 0.35
145 0.41
146 0.45
147 0.51
148 0.5
149 0.57
150 0.54
151 0.49
152 0.49
153 0.5
154 0.45
155 0.44
156 0.48
157 0.51
158 0.58
159 0.57
160 0.58
161 0.53
162 0.55
163 0.51
164 0.46
165 0.4
166 0.34
167 0.34
168 0.29
169 0.27
170 0.21
171 0.17
172 0.13
173 0.08
174 0.06
175 0.03
176 0.03
177 0.05
178 0.06
179 0.07
180 0.08
181 0.08
182 0.09
183 0.09
184 0.09
185 0.08
186 0.08
187 0.07
188 0.06
189 0.06
190 0.06
191 0.06
192 0.08
193 0.08
194 0.08
195 0.08
196 0.08
197 0.12
198 0.13
199 0.12
200 0.1
201 0.1
202 0.12
203 0.13