FuNGI

A0A194SBL8

Protein Details

Accession

A0A194SBL8

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
498-517	EDRAARDRSARKKRGVGATW	Hydrophilic

NLS Segment(s)

Position	Sequence
507-510	ARKK

Subcellular Location(s)

plas 22, extr 2, E.R. 2

Family & Domain DBs

InterPro	View protein in InterPro IPR021134 Bestrophin-like IPR044669 YneE/VCCN1/2-like
Gene Ontology	GO:0016020 C:membrane GO:0005254 F:chloride channel activity
Pfam	View protein in Pfam PF01062 Bestrophin
PROSITE	View protein in PROSITE PS51257 PROKAR_LIPOPROTEIN

Amino Acid Sequences

MSVIARSVGHTVWPEIAGPVFLFTLCGVAVTVGCEVSGYAMKVNTIMLSVLTTMLSFVVSLRTSSALERWNAGRQAWSTLSVASRNLGSLIWIHVGSTTLTPTEQAEIVTGSDEDEIERLKSLIEKRTMLNLIQAFATATKHHVRGESGAFYDDLYDLVKPLPKYSFPSGIDDQNGIARETVTGIWRSPLPDGTYVIPTSMTSSMSSSPSGAATPRFGSASTSQLGHLDLEKGTVDGIDGIGELGRVAREGDSTSREIKLAPGYNPPPRGLYHYAPAFLLFRPIVSLFKPVEKKHKLSFGTNLPLEIHLHLSGYLSTLMQRGTIPTPLVSVYYASINSLADSLGTMERVLSTPLPFSYIVHLRATAYVYLVLLPFQIYASLKWLTIPAMFVAACVFLGFLELGEQLQQPFGYDDSDHDLDKYCALVAAELQEIAAHSPPTASSFVFSSLNTPFKPFDRRSAPEILASFSEKHGGTDQDVVKGVPGMRHFLTRHWHELEDRAARDRSARKKRGVGATWTKTDEDGRMVHVCTLK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.17
2	0.16
3	0.16
4	0.14
5	0.12
6	0.11
7	0.1
8	0.09
9	0.09
10	0.08
11	0.09
12	0.07
13	0.08
14	0.06
15	0.06
16	0.07
17	0.07
18	0.08
19	0.07
20	0.07
21	0.07
22	0.06
23	0.08
24	0.1
25	0.1
26	0.11
27	0.11
28	0.12
29	0.12
30	0.13
31	0.11
32	0.09
33	0.09
34	0.07
35	0.07
36	0.08
37	0.08
38	0.07
39	0.07
40	0.06
41	0.06
42	0.06
43	0.05
44	0.05
45	0.09
46	0.09
47	0.09
48	0.1
49	0.12
50	0.13
51	0.14
52	0.18
53	0.2
54	0.2
55	0.24
56	0.25
57	0.3
58	0.32
59	0.31
60	0.31
61	0.27
62	0.32
63	0.3
64	0.29
65	0.23
66	0.23
67	0.25
68	0.22
69	0.21
70	0.17
71	0.16
72	0.14
73	0.13
74	0.11
75	0.1
76	0.09
77	0.11
78	0.11
79	0.11
80	0.1
81	0.1
82	0.11
83	0.11
84	0.11
85	0.1
86	0.08
87	0.09
88	0.09
89	0.1
90	0.11
91	0.1
92	0.1
93	0.09
94	0.09
95	0.1
96	0.1
97	0.09
98	0.08
99	0.07
100	0.07
101	0.07
102	0.07
103	0.08
104	0.07
105	0.08
106	0.07
107	0.07
108	0.13
109	0.17
110	0.24
111	0.27
112	0.29
113	0.3
114	0.36
115	0.38
116	0.33
117	0.34
118	0.28
119	0.24
120	0.22
121	0.21
122	0.15
123	0.14
124	0.14
125	0.09
126	0.12
127	0.15
128	0.17
129	0.18
130	0.2
131	0.2
132	0.23
133	0.26
134	0.24
135	0.21
136	0.2
137	0.18
138	0.17
139	0.16
140	0.12
141	0.09
142	0.08
143	0.07
144	0.06
145	0.08
146	0.11
147	0.11
148	0.13
149	0.15
150	0.16
151	0.22
152	0.26
153	0.32
154	0.3
155	0.36
156	0.36
157	0.37
158	0.36
159	0.31
160	0.27
161	0.22
162	0.21
163	0.15
164	0.13
165	0.1
166	0.09
167	0.1
168	0.1
169	0.1
170	0.1
171	0.1
172	0.11
173	0.12
174	0.13
175	0.13
176	0.14
177	0.14
178	0.14
179	0.16
180	0.16
181	0.18
182	0.16
183	0.16
184	0.13
185	0.11
186	0.12
187	0.11
188	0.1
189	0.09
190	0.1
191	0.11
192	0.13
193	0.13
194	0.11
195	0.1
196	0.1
197	0.1
198	0.1
199	0.09
200	0.09
201	0.1
202	0.1
203	0.1
204	0.1
205	0.12
206	0.13
207	0.15
208	0.14
209	0.13
210	0.13
211	0.13
212	0.13
213	0.11
214	0.1
215	0.08
216	0.08
217	0.08
218	0.07
219	0.07
220	0.06
221	0.06
222	0.05
223	0.04
224	0.04
225	0.03
226	0.03
227	0.03
228	0.03
229	0.03
230	0.03
231	0.03
232	0.03
233	0.03
234	0.03
235	0.04
236	0.04
237	0.05
238	0.07
239	0.1
240	0.12
241	0.13
242	0.13
243	0.13
244	0.13
245	0.13
246	0.16
247	0.16
248	0.16
249	0.2
250	0.23
251	0.27
252	0.29
253	0.28
254	0.26
255	0.24
256	0.28
257	0.27
258	0.25
259	0.25
260	0.25
261	0.24
262	0.23
263	0.23
264	0.18
265	0.13
266	0.14
267	0.09
268	0.08
269	0.08
270	0.09
271	0.09
272	0.09
273	0.13
274	0.11
275	0.17
276	0.22
277	0.23
278	0.33
279	0.37
280	0.4
281	0.4
282	0.47
283	0.44
284	0.42
285	0.45
286	0.41
287	0.42
288	0.38
289	0.35
290	0.27
291	0.26
292	0.24
293	0.19
294	0.15
295	0.09
296	0.09
297	0.08
298	0.08
299	0.07
300	0.07
301	0.07
302	0.05
303	0.06
304	0.07
305	0.07
306	0.07
307	0.07
308	0.08
309	0.09
310	0.11
311	0.11
312	0.1
313	0.1
314	0.1
315	0.11
316	0.09
317	0.08
318	0.07
319	0.08
320	0.08
321	0.07
322	0.08
323	0.07
324	0.07
325	0.07
326	0.06
327	0.04
328	0.04
329	0.06
330	0.05
331	0.06
332	0.05
333	0.05
334	0.06
335	0.06
336	0.08
337	0.07
338	0.08
339	0.09
340	0.09
341	0.11
342	0.11
343	0.11
344	0.15
345	0.18
346	0.2
347	0.19
348	0.2
349	0.18
350	0.19
351	0.19
352	0.15
353	0.11
354	0.09
355	0.09
356	0.09
357	0.08
358	0.07
359	0.06
360	0.06
361	0.05
362	0.05
363	0.07
364	0.07
365	0.07
366	0.11
367	0.11
368	0.11
369	0.11
370	0.12
371	0.11
372	0.11
373	0.12
374	0.08
375	0.09
376	0.09
377	0.09
378	0.08
379	0.07
380	0.07
381	0.06
382	0.06
383	0.03
384	0.04
385	0.04
386	0.04
387	0.05
388	0.05
389	0.05
390	0.06
391	0.07
392	0.07
393	0.08
394	0.07
395	0.07
396	0.08
397	0.09
398	0.09
399	0.09
400	0.1
401	0.16
402	0.18
403	0.17
404	0.17
405	0.18
406	0.17
407	0.17
408	0.16
409	0.09
410	0.09
411	0.09
412	0.09
413	0.08
414	0.09
415	0.09
416	0.08
417	0.08
418	0.07
419	0.07
420	0.08
421	0.09
422	0.07
423	0.07
424	0.07
425	0.08
426	0.11
427	0.12
428	0.11
429	0.11
430	0.11
431	0.14
432	0.15
433	0.15
434	0.15
435	0.18
436	0.23
437	0.22
438	0.24
439	0.24
440	0.27
441	0.36
442	0.36
443	0.4
444	0.45
445	0.49
446	0.51
447	0.56
448	0.52
449	0.48
450	0.47
451	0.39
452	0.33
453	0.31
454	0.27
455	0.21
456	0.24
457	0.19
458	0.2
459	0.21
460	0.21
461	0.2
462	0.27
463	0.28
464	0.27
465	0.27
466	0.25
467	0.23
468	0.24
469	0.23
470	0.19
471	0.19
472	0.21
473	0.21
474	0.28
475	0.28
476	0.3
477	0.38
478	0.4
479	0.46
480	0.44
481	0.46
482	0.42
483	0.46
484	0.49
485	0.47
486	0.44
487	0.43
488	0.4
489	0.38
490	0.44
491	0.48
492	0.51
493	0.55
494	0.61
495	0.63
496	0.7
497	0.78
498	0.8
499	0.77
500	0.76
501	0.76
502	0.75
503	0.73
504	0.67
505	0.6
506	0.51
507	0.48
508	0.4
509	0.33
510	0.27
511	0.26
512	0.26
513	0.27

A0A194SBL8

3D AlphaFold-predicted Structure Viewer