Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194S232

Protein Details
Accession A0A194S232    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
97-126RARHLPPGRRRRHVDQRRLERRRRARPGAABasic
NLS Segment(s)
PositionSequence
95-126GLRARHLPPGRRRRHVDQRRLERRRRARPGAA
Subcellular Location(s) nucl 13, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences APYTRTHGHYTYKRRASAHPGCRPLRTFLHPRPPQPRSPTAQLATRSERGHGLLRLPKLRPPERRVQAEHGPLQLVRHDPRPAVQLAAEQLVRPGLRARHLPPGRRRRHVDQRRLERRRRARPGAAAPATAAGDVEPGAAAERAGAQRRAAGRATRVGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.66
3 0.67
4 0.68
5 0.68
6 0.67
7 0.69
8 0.67
9 0.69
10 0.65
11 0.6
12 0.56
13 0.52
14 0.53
15 0.52
16 0.6
17 0.6
18 0.66
19 0.7
20 0.69
21 0.7
22 0.68
23 0.67
24 0.62
25 0.63
26 0.62
27 0.55
28 0.56
29 0.51
30 0.49
31 0.48
32 0.46
33 0.4
34 0.34
35 0.32
36 0.29
37 0.29
38 0.25
39 0.25
40 0.25
41 0.29
42 0.32
43 0.32
44 0.33
45 0.38
46 0.44
47 0.47
48 0.48
49 0.54
50 0.57
51 0.61
52 0.62
53 0.6
54 0.58
55 0.55
56 0.51
57 0.42
58 0.35
59 0.29
60 0.26
61 0.21
62 0.18
63 0.14
64 0.16
65 0.16
66 0.15
67 0.16
68 0.18
69 0.17
70 0.14
71 0.13
72 0.11
73 0.11
74 0.12
75 0.11
76 0.08
77 0.08
78 0.09
79 0.09
80 0.08
81 0.1
82 0.1
83 0.13
84 0.17
85 0.19
86 0.28
87 0.33
88 0.41
89 0.48
90 0.58
91 0.63
92 0.67
93 0.72
94 0.7
95 0.78
96 0.8
97 0.8
98 0.8
99 0.83
100 0.86
101 0.89
102 0.88
103 0.87
104 0.87
105 0.87
106 0.87
107 0.84
108 0.79
109 0.79
110 0.78
111 0.78
112 0.69
113 0.58
114 0.49
115 0.42
116 0.35
117 0.26
118 0.18
119 0.08
120 0.07
121 0.06
122 0.06
123 0.04
124 0.04
125 0.05
126 0.05
127 0.05
128 0.05
129 0.09
130 0.13
131 0.18
132 0.19
133 0.19
134 0.24
135 0.27
136 0.3
137 0.31
138 0.31
139 0.32