Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P9EMQ3

Protein Details
Accession A0A0P9EMQ3   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
79-100KGHSCYRPRRDGERKRKSVRGCBasic
181-211LVTPERLQRRRHLRSLKRRKTESQKAQKAEYHydrophilic
NLS Segment(s)
PositionSequence
90-95GERKRK
133-142LGPKRATKIR
159-206RREVVPKKEGAKPYTKAPKIQRLVTPERLQRRRHLRSLKRRKTESQKA
222-224RKQ
226-237ASAVKAKKAAAR
Subcellular Location(s) cyto_nucl 13.333, cyto 13, nucl 11.5, mito_nucl 7.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR014401  Ribosomal_S6_euk  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
Amino Acid Sequences MKLCFANPATGQQKTIEIDDERKTRIFYEKRMAQEVPADALGDEFKGYVVRITGGNDKQGFPLKQGVLVPHRVKLLLAKGHSCYRPRRDGERKRKSVRGCIVGPDVRALHLVVVKQGESDIPGLTDTVLPKRLGPKRATKIRRFFNLDKSDDVRKFVIRREVVPKKEGAKPYTKAPKIQRLVTPERLQRRRHLRSLKRRKTESQKAQKAEYEVVVAKRLAERKQVASAVKAKKAAARSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.27
4 0.25
5 0.29
6 0.34
7 0.37
8 0.36
9 0.35
10 0.35
11 0.32
12 0.4
13 0.4
14 0.4
15 0.46
16 0.49
17 0.53
18 0.57
19 0.54
20 0.46
21 0.45
22 0.39
23 0.32
24 0.25
25 0.21
26 0.16
27 0.16
28 0.14
29 0.09
30 0.08
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.07
37 0.07
38 0.08
39 0.11
40 0.18
41 0.19
42 0.25
43 0.25
44 0.26
45 0.27
46 0.34
47 0.31
48 0.26
49 0.31
50 0.26
51 0.27
52 0.27
53 0.29
54 0.26
55 0.34
56 0.33
57 0.29
58 0.29
59 0.26
60 0.25
61 0.24
62 0.26
63 0.23
64 0.23
65 0.23
66 0.25
67 0.31
68 0.34
69 0.36
70 0.38
71 0.4
72 0.47
73 0.49
74 0.56
75 0.62
76 0.7
77 0.76
78 0.79
79 0.82
80 0.79
81 0.82
82 0.76
83 0.74
84 0.7
85 0.64
86 0.54
87 0.48
88 0.47
89 0.41
90 0.37
91 0.3
92 0.23
93 0.17
94 0.16
95 0.13
96 0.09
97 0.09
98 0.08
99 0.08
100 0.08
101 0.08
102 0.07
103 0.07
104 0.06
105 0.06
106 0.06
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.07
113 0.06
114 0.08
115 0.1
116 0.1
117 0.11
118 0.2
119 0.24
120 0.29
121 0.32
122 0.4
123 0.47
124 0.57
125 0.65
126 0.65
127 0.69
128 0.7
129 0.73
130 0.72
131 0.66
132 0.66
133 0.65
134 0.58
135 0.53
136 0.5
137 0.5
138 0.43
139 0.42
140 0.34
141 0.3
142 0.29
143 0.3
144 0.35
145 0.29
146 0.32
147 0.4
148 0.47
149 0.46
150 0.47
151 0.46
152 0.42
153 0.47
154 0.48
155 0.43
156 0.42
157 0.41
158 0.48
159 0.55
160 0.53
161 0.54
162 0.56
163 0.62
164 0.59
165 0.62
166 0.58
167 0.56
168 0.61
169 0.61
170 0.61
171 0.58
172 0.64
173 0.66
174 0.65
175 0.66
176 0.69
177 0.69
178 0.72
179 0.76
180 0.76
181 0.8
182 0.88
183 0.89
184 0.88
185 0.87
186 0.87
187 0.87
188 0.87
189 0.87
190 0.87
191 0.86
192 0.8
193 0.78
194 0.72
195 0.65
196 0.57
197 0.46
198 0.39
199 0.34
200 0.31
201 0.29
202 0.25
203 0.22
204 0.25
205 0.29
206 0.29
207 0.34
208 0.37
209 0.38
210 0.44
211 0.48
212 0.44
213 0.46
214 0.51
215 0.5
216 0.51
217 0.49
218 0.45
219 0.45