Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194S4X5

Protein Details
Accession A0A194S4X5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
86-113HDPRRLPEAWHRPRRRPRPPRARFAQPVBasic
221-247HSVSRSSPRGLRRRPRSSCCHYKQCPYHydrophilic
NLS Segment(s)
PositionSequence
89-108RRLPEAWHRPRRRPRPPRAR
Subcellular Location(s) nucl 9cyto_nucl 9, cyto 7, mito 6, extr 2, pero 2
Family & Domain DBs
Amino Acid Sequences PDSHLDSKHAQPLVVRQLHLDLGFRLVRLDVVLVVARRFRLPRAGRVDPAARHRRLVAQDAEPPVARLLPRFDEPALSLLVPSRSHDPRRLPEAWHRPRRRPRPPRARFAQPVVVREEQHVQLDVVVLVGRLGVLEALAQVHSQARHVAQASLRTRSTITGSPSPHAVQLYHHAPSRRTIRSSGTSRRSPPFTIQPPWTQERTLTLFEQKTRSHCQGGRVHSVSRSSPRGLRRRPRSSCCHYKQCPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.38
3 0.32
4 0.33
5 0.35
6 0.34
7 0.28
8 0.18
9 0.19
10 0.19
11 0.18
12 0.16
13 0.14
14 0.13
15 0.12
16 0.12
17 0.07
18 0.08
19 0.11
20 0.11
21 0.12
22 0.14
23 0.14
24 0.17
25 0.18
26 0.19
27 0.27
28 0.3
29 0.38
30 0.45
31 0.48
32 0.47
33 0.51
34 0.55
35 0.49
36 0.56
37 0.56
38 0.48
39 0.45
40 0.45
41 0.46
42 0.44
43 0.45
44 0.39
45 0.33
46 0.38
47 0.38
48 0.39
49 0.32
50 0.29
51 0.24
52 0.21
53 0.17
54 0.13
55 0.14
56 0.15
57 0.17
58 0.19
59 0.19
60 0.18
61 0.19
62 0.19
63 0.16
64 0.13
65 0.11
66 0.1
67 0.12
68 0.11
69 0.12
70 0.16
71 0.21
72 0.25
73 0.31
74 0.35
75 0.38
76 0.45
77 0.45
78 0.43
79 0.48
80 0.56
81 0.6
82 0.64
83 0.65
84 0.69
85 0.77
86 0.84
87 0.85
88 0.85
89 0.86
90 0.87
91 0.88
92 0.88
93 0.83
94 0.82
95 0.74
96 0.68
97 0.65
98 0.56
99 0.51
100 0.46
101 0.42
102 0.33
103 0.3
104 0.28
105 0.21
106 0.19
107 0.17
108 0.12
109 0.1
110 0.1
111 0.08
112 0.06
113 0.04
114 0.04
115 0.03
116 0.03
117 0.03
118 0.02
119 0.02
120 0.02
121 0.02
122 0.02
123 0.02
124 0.03
125 0.03
126 0.03
127 0.03
128 0.05
129 0.05
130 0.06
131 0.07
132 0.07
133 0.1
134 0.11
135 0.12
136 0.12
137 0.2
138 0.22
139 0.25
140 0.24
141 0.23
142 0.23
143 0.22
144 0.24
145 0.2
146 0.22
147 0.24
148 0.26
149 0.26
150 0.27
151 0.27
152 0.25
153 0.22
154 0.18
155 0.14
156 0.18
157 0.2
158 0.2
159 0.23
160 0.24
161 0.24
162 0.3
163 0.36
164 0.35
165 0.35
166 0.35
167 0.38
168 0.44
169 0.5
170 0.54
171 0.53
172 0.55
173 0.58
174 0.61
175 0.59
176 0.54
177 0.52
178 0.52
179 0.51
180 0.51
181 0.5
182 0.51
183 0.52
184 0.55
185 0.51
186 0.42
187 0.37
188 0.36
189 0.36
190 0.33
191 0.3
192 0.32
193 0.33
194 0.36
195 0.41
196 0.39
197 0.4
198 0.44
199 0.46
200 0.47
201 0.46
202 0.51
203 0.53
204 0.57
205 0.6
206 0.55
207 0.53
208 0.49
209 0.5
210 0.46
211 0.45
212 0.44
213 0.39
214 0.42
215 0.49
216 0.57
217 0.63
218 0.69
219 0.73
220 0.79
221 0.84
222 0.87
223 0.87
224 0.87
225 0.87
226 0.86
227 0.86