Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P9EN74

Protein Details
Accession A0A0P9EN74   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
106-141QGEPTLRERRRQGRRARRRRKAREKELKRRRVFIKEBasic
NLS Segment(s)
PositionSequence
112-136RERRRQGRRARRRRKAREKELKRRR
Subcellular Location(s) plas 20, mito 3, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010619  ThrE-like_N  
IPR024528  ThrE_2  
Gene Ontology GO:0016020  C:membrane  
GO:0022857  F:transmembrane transporter activity  
Pfam View protein in Pfam  
PF06738  ThrE  
PF12821  ThrE_2  
Amino Acid Sequences MLGATALAGPASPSGTRVAPLPTRPGYNLSRYSAPNVNESSRASAKPSSIALPPSPAVAPSRRTLSPPPSTRLSPPHSPGVMLRASPTPSRKSLSDMVREEEEKDQGEPTLRERRRQGRRARRRRKAREKELKRRRVFIKEHVAAILERQQFILKLARAFMMFGAPSHRLEAQIQATARVLELPHCTAMYLPGVLLVNFGDPATCTSDIKFLKQAAGLDLGKLKASYYVYNKVIRDKVSVADAATQLDDLMTSPPKYSLVKNAVIGGLAGAFIMPSAFNGSFIDCLAAIPLGSLLVIVQVLLARNDMYSSLFEIVIACVNAMVAGALTRTNQFCFYAVASGSIVLILPGFITLCAALELANRSITSGAVRLTYAALYCLFLGFGLSLGAEIYVRVARSEIINGADYTCSYLRDGAPWWRQNIPKWWYFLTIPSFLLCMALKNGQPLFRRDTLAMVVIGSAGFSANFFSGWEFKNQPALTSFIGSFVAGILGNTWSRLTRESAFVVMIVGIFVQLPSGLANGGLLRFAADSSSNGQGYGTAIDAAAGLITIVIGMTVGLFLAAAVMNLLSRRGRRRGAHLSTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.13
4 0.15
5 0.21
6 0.24
7 0.28
8 0.34
9 0.35
10 0.38
11 0.39
12 0.44
13 0.42
14 0.45
15 0.47
16 0.44
17 0.46
18 0.45
19 0.48
20 0.49
21 0.45
22 0.43
23 0.42
24 0.4
25 0.38
26 0.38
27 0.38
28 0.36
29 0.36
30 0.34
31 0.33
32 0.31
33 0.31
34 0.31
35 0.28
36 0.27
37 0.3
38 0.27
39 0.28
40 0.27
41 0.25
42 0.24
43 0.22
44 0.23
45 0.23
46 0.26
47 0.25
48 0.3
49 0.29
50 0.34
51 0.4
52 0.44
53 0.49
54 0.52
55 0.53
56 0.54
57 0.55
58 0.56
59 0.58
60 0.56
61 0.54
62 0.52
63 0.54
64 0.5
65 0.48
66 0.43
67 0.4
68 0.35
69 0.28
70 0.26
71 0.21
72 0.24
73 0.28
74 0.32
75 0.32
76 0.34
77 0.37
78 0.36
79 0.38
80 0.43
81 0.45
82 0.49
83 0.47
84 0.47
85 0.47
86 0.47
87 0.44
88 0.39
89 0.34
90 0.26
91 0.24
92 0.21
93 0.18
94 0.21
95 0.2
96 0.23
97 0.31
98 0.33
99 0.38
100 0.46
101 0.55
102 0.62
103 0.7
104 0.75
105 0.75
106 0.85
107 0.9
108 0.92
109 0.93
110 0.94
111 0.96
112 0.96
113 0.96
114 0.96
115 0.96
116 0.96
117 0.96
118 0.96
119 0.95
120 0.89
121 0.86
122 0.81
123 0.8
124 0.75
125 0.73
126 0.72
127 0.65
128 0.61
129 0.53
130 0.47
131 0.37
132 0.33
133 0.32
134 0.22
135 0.19
136 0.19
137 0.19
138 0.18
139 0.2
140 0.24
141 0.18
142 0.17
143 0.18
144 0.19
145 0.18
146 0.18
147 0.16
148 0.12
149 0.1
150 0.09
151 0.12
152 0.13
153 0.13
154 0.15
155 0.15
156 0.14
157 0.15
158 0.19
159 0.17
160 0.2
161 0.19
162 0.18
163 0.18
164 0.17
165 0.16
166 0.12
167 0.11
168 0.09
169 0.12
170 0.12
171 0.13
172 0.12
173 0.12
174 0.11
175 0.12
176 0.11
177 0.08
178 0.07
179 0.08
180 0.08
181 0.08
182 0.08
183 0.07
184 0.06
185 0.06
186 0.06
187 0.04
188 0.04
189 0.06
190 0.1
191 0.11
192 0.11
193 0.11
194 0.19
195 0.19
196 0.21
197 0.23
198 0.19
199 0.2
200 0.21
201 0.21
202 0.16
203 0.2
204 0.18
205 0.15
206 0.16
207 0.15
208 0.14
209 0.13
210 0.12
211 0.1
212 0.11
213 0.14
214 0.17
215 0.23
216 0.27
217 0.31
218 0.32
219 0.34
220 0.36
221 0.33
222 0.31
223 0.26
224 0.24
225 0.21
226 0.21
227 0.16
228 0.15
229 0.14
230 0.12
231 0.11
232 0.09
233 0.07
234 0.07
235 0.06
236 0.04
237 0.06
238 0.07
239 0.07
240 0.08
241 0.08
242 0.1
243 0.12
244 0.12
245 0.18
246 0.22
247 0.23
248 0.24
249 0.24
250 0.23
251 0.21
252 0.2
253 0.12
254 0.07
255 0.05
256 0.04
257 0.02
258 0.02
259 0.02
260 0.02
261 0.02
262 0.02
263 0.05
264 0.05
265 0.06
266 0.06
267 0.07
268 0.07
269 0.07
270 0.07
271 0.05
272 0.05
273 0.04
274 0.04
275 0.04
276 0.03
277 0.03
278 0.03
279 0.02
280 0.02
281 0.02
282 0.02
283 0.02
284 0.02
285 0.02
286 0.03
287 0.03
288 0.04
289 0.04
290 0.04
291 0.04
292 0.04
293 0.05
294 0.05
295 0.05
296 0.06
297 0.07
298 0.07
299 0.07
300 0.07
301 0.07
302 0.07
303 0.06
304 0.05
305 0.04
306 0.04
307 0.04
308 0.03
309 0.03
310 0.02
311 0.02
312 0.02
313 0.03
314 0.04
315 0.06
316 0.06
317 0.07
318 0.09
319 0.09
320 0.09
321 0.1
322 0.1
323 0.1
324 0.1
325 0.1
326 0.09
327 0.08
328 0.08
329 0.06
330 0.06
331 0.04
332 0.04
333 0.03
334 0.02
335 0.02
336 0.03
337 0.02
338 0.03
339 0.03
340 0.03
341 0.03
342 0.03
343 0.04
344 0.05
345 0.07
346 0.07
347 0.08
348 0.08
349 0.08
350 0.08
351 0.08
352 0.08
353 0.07
354 0.07
355 0.07
356 0.07
357 0.08
358 0.08
359 0.08
360 0.07
361 0.07
362 0.07
363 0.06
364 0.06
365 0.06
366 0.05
367 0.05
368 0.05
369 0.04
370 0.04
371 0.03
372 0.03
373 0.03
374 0.03
375 0.03
376 0.03
377 0.03
378 0.04
379 0.05
380 0.05
381 0.06
382 0.06
383 0.07
384 0.08
385 0.09
386 0.09
387 0.1
388 0.11
389 0.11
390 0.11
391 0.11
392 0.1
393 0.12
394 0.11
395 0.11
396 0.1
397 0.12
398 0.12
399 0.14
400 0.16
401 0.21
402 0.3
403 0.32
404 0.35
405 0.38
406 0.42
407 0.45
408 0.52
409 0.49
410 0.44
411 0.44
412 0.42
413 0.4
414 0.37
415 0.37
416 0.32
417 0.29
418 0.26
419 0.23
420 0.21
421 0.18
422 0.19
423 0.14
424 0.1
425 0.1
426 0.13
427 0.14
428 0.18
429 0.2
430 0.24
431 0.26
432 0.29
433 0.33
434 0.33
435 0.35
436 0.31
437 0.32
438 0.27
439 0.26
440 0.22
441 0.16
442 0.13
443 0.1
444 0.09
445 0.07
446 0.05
447 0.04
448 0.03
449 0.03
450 0.05
451 0.05
452 0.05
453 0.05
454 0.07
455 0.11
456 0.12
457 0.17
458 0.19
459 0.2
460 0.28
461 0.28
462 0.28
463 0.26
464 0.28
465 0.24
466 0.24
467 0.23
468 0.16
469 0.17
470 0.15
471 0.13
472 0.09
473 0.09
474 0.06
475 0.06
476 0.06
477 0.07
478 0.07
479 0.08
480 0.09
481 0.09
482 0.11
483 0.13
484 0.17
485 0.17
486 0.21
487 0.22
488 0.23
489 0.22
490 0.2
491 0.19
492 0.14
493 0.12
494 0.08
495 0.06
496 0.05
497 0.04
498 0.04
499 0.04
500 0.04
501 0.04
502 0.04
503 0.05
504 0.05
505 0.05
506 0.05
507 0.06
508 0.07
509 0.06
510 0.06
511 0.06
512 0.07
513 0.07
514 0.07
515 0.07
516 0.09
517 0.13
518 0.18
519 0.17
520 0.17
521 0.17
522 0.16
523 0.16
524 0.15
525 0.12
526 0.08
527 0.08
528 0.08
529 0.08
530 0.07
531 0.06
532 0.04
533 0.03
534 0.03
535 0.03
536 0.03
537 0.02
538 0.02
539 0.02
540 0.02
541 0.02
542 0.02
543 0.03
544 0.02
545 0.03
546 0.02
547 0.04
548 0.04
549 0.04
550 0.04
551 0.04
552 0.05
553 0.06
554 0.09
555 0.13
556 0.2
557 0.28
558 0.35
559 0.44
560 0.48
561 0.58
562 0.66