Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194S5W3

Protein Details
Accession A0A194S5W3    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
82-101YLKYLTKKFLKKNQMREWLRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, mito_nucl 8.833, cyto_nucl 4.833, cyto 4.5, nucl 4, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAPSVVSAKKQTKVKVAPTKFVIDYSGPANDKIFDAAAYEKFLVDHIKVEGKTGQLGDDVKLQREGSGKLSVTSTVPFSKRYLKYLTKKFLKKNQMREWLRVVSTDKSTYTLRFYNLSFDQEAEAQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.67
3 0.65
4 0.65
5 0.63
6 0.63
7 0.54
8 0.47
9 0.39
10 0.29
11 0.27
12 0.22
13 0.24
14 0.2
15 0.19
16 0.19
17 0.17
18 0.17
19 0.16
20 0.14
21 0.08
22 0.09
23 0.11
24 0.11
25 0.12
26 0.11
27 0.1
28 0.1
29 0.11
30 0.11
31 0.09
32 0.1
33 0.09
34 0.14
35 0.14
36 0.15
37 0.16
38 0.14
39 0.15
40 0.14
41 0.13
42 0.1
43 0.11
44 0.1
45 0.15
46 0.15
47 0.14
48 0.16
49 0.15
50 0.15
51 0.17
52 0.17
53 0.14
54 0.16
55 0.16
56 0.15
57 0.15
58 0.14
59 0.13
60 0.13
61 0.12
62 0.12
63 0.13
64 0.14
65 0.16
66 0.25
67 0.26
68 0.29
69 0.34
70 0.4
71 0.48
72 0.56
73 0.63
74 0.63
75 0.69
76 0.74
77 0.76
78 0.78
79 0.77
80 0.79
81 0.79
82 0.81
83 0.77
84 0.73
85 0.7
86 0.63
87 0.56
88 0.48
89 0.42
90 0.35
91 0.35
92 0.33
93 0.27
94 0.26
95 0.27
96 0.26
97 0.28
98 0.27
99 0.25
100 0.26
101 0.25
102 0.29
103 0.3
104 0.32
105 0.27
106 0.25
107 0.25