Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M9VVT5

Protein Details
Accession A0A0M9VVT5   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTGKKQSPRKPKWDAERILTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR028020  ASX_DEUBAD_dom  
IPR044867  DEUBAD_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF13919  ASXH  
PROSITE View protein in PROSITE  
PS51916  DEUBAD  
Amino Acid Sequences MTGKKQSPRKPKWDAERILTDPKSPLARANLRTILSHPMAWSVLDAEEKAEILSLFPDKEHILDPDTDDARPDLRSLLNDDSFRYDCAAYTTNLALGRHDPEWLASAWGAQERRRIGDFDEFLIGKLRDDWGVELPDEMKLFRTPAQSAVPDEREGVPATNGSGCLGGGAAGEMRMDLEMPEDKVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.79
3 0.77
4 0.72
5 0.71
6 0.62
7 0.53
8 0.45
9 0.43
10 0.39
11 0.32
12 0.32
13 0.31
14 0.38
15 0.39
16 0.44
17 0.45
18 0.42
19 0.43
20 0.4
21 0.38
22 0.32
23 0.3
24 0.23
25 0.2
26 0.19
27 0.18
28 0.16
29 0.11
30 0.1
31 0.09
32 0.09
33 0.08
34 0.08
35 0.08
36 0.07
37 0.07
38 0.06
39 0.05
40 0.07
41 0.07
42 0.07
43 0.07
44 0.09
45 0.09
46 0.1
47 0.11
48 0.11
49 0.11
50 0.12
51 0.13
52 0.16
53 0.17
54 0.16
55 0.15
56 0.14
57 0.13
58 0.13
59 0.12
60 0.09
61 0.09
62 0.1
63 0.13
64 0.16
65 0.18
66 0.18
67 0.18
68 0.21
69 0.21
70 0.2
71 0.17
72 0.14
73 0.11
74 0.13
75 0.14
76 0.1
77 0.11
78 0.1
79 0.11
80 0.12
81 0.12
82 0.1
83 0.1
84 0.12
85 0.11
86 0.11
87 0.09
88 0.08
89 0.1
90 0.09
91 0.09
92 0.07
93 0.07
94 0.07
95 0.1
96 0.11
97 0.11
98 0.15
99 0.16
100 0.18
101 0.19
102 0.2
103 0.19
104 0.25
105 0.24
106 0.21
107 0.23
108 0.2
109 0.19
110 0.23
111 0.2
112 0.13
113 0.13
114 0.13
115 0.11
116 0.11
117 0.12
118 0.11
119 0.13
120 0.12
121 0.12
122 0.12
123 0.13
124 0.13
125 0.11
126 0.1
127 0.1
128 0.12
129 0.14
130 0.17
131 0.17
132 0.2
133 0.24
134 0.24
135 0.27
136 0.31
137 0.3
138 0.28
139 0.29
140 0.26
141 0.24
142 0.23
143 0.21
144 0.16
145 0.13
146 0.14
147 0.13
148 0.12
149 0.11
150 0.1
151 0.09
152 0.08
153 0.07
154 0.06
155 0.05
156 0.05
157 0.05
158 0.05
159 0.05
160 0.05
161 0.05
162 0.05
163 0.05
164 0.05
165 0.08
166 0.11