Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M8N6U0

Protein Details
Accession A0A0M8N6U0    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
118-137EQKKAADKAKEKHRLKKLAKBasic
NLS Segment(s)
PositionSequence
119-137QKKAADKAKEKHRLKKLAK
Subcellular Location(s) cyto_nucl 11, nucl 10, cyto 10, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR044642  PTHR15588  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
Amino Acid Sequences MTMTDAPPGGHHSPPQAGANPHAVPQLPPQMFTTAAQLLDLTDTNIVLQSTTERIFAPNAGRAAATDPYGYFADVAHGIFLVRGENVLLLGEIDLDRDDDPPAGYEPAELDVVKRMAEQKKAADKAKEKHRLKKLAKIGFEGENLGDIFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.3
4 0.28
5 0.29
6 0.33
7 0.3
8 0.29
9 0.27
10 0.25
11 0.21
12 0.24
13 0.31
14 0.25
15 0.26
16 0.26
17 0.26
18 0.27
19 0.26
20 0.25
21 0.17
22 0.16
23 0.15
24 0.13
25 0.11
26 0.11
27 0.11
28 0.07
29 0.06
30 0.06
31 0.06
32 0.07
33 0.06
34 0.05
35 0.05
36 0.06
37 0.08
38 0.09
39 0.1
40 0.09
41 0.1
42 0.11
43 0.13
44 0.13
45 0.14
46 0.14
47 0.14
48 0.13
49 0.13
50 0.14
51 0.13
52 0.12
53 0.08
54 0.08
55 0.1
56 0.1
57 0.1
58 0.08
59 0.07
60 0.07
61 0.07
62 0.07
63 0.05
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.04
81 0.04
82 0.05
83 0.05
84 0.06
85 0.07
86 0.07
87 0.07
88 0.08
89 0.09
90 0.09
91 0.08
92 0.08
93 0.08
94 0.09
95 0.1
96 0.09
97 0.08
98 0.11
99 0.12
100 0.12
101 0.12
102 0.18
103 0.21
104 0.26
105 0.29
106 0.33
107 0.42
108 0.48
109 0.52
110 0.54
111 0.57
112 0.61
113 0.69
114 0.72
115 0.7
116 0.74
117 0.79
118 0.81
119 0.79
120 0.8
121 0.79
122 0.77
123 0.73
124 0.68
125 0.61
126 0.54
127 0.5
128 0.41
129 0.32
130 0.25