Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M8N3X8

Protein Details
Accession A0A0M8N3X8   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-30KAHTGKRVTKDGKTRRHKKDPLAPKRSLBasic
NLS Segment(s)
PositionSequence
7-27GKRVTKDGKTRRHKKDPLAPK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKAHTGKRVTKDGKTRRHKKDPLAPKRSLSAYMFFASEHRELVREECPGISFGGIGKMLGERWKKLNEKQRAPYEAKAAADKKRYEDEKAAYNAADEEESC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.78
3 0.82
4 0.82
5 0.87
6 0.87
7 0.86
8 0.86
9 0.87
10 0.87
11 0.84
12 0.77
13 0.68
14 0.65
15 0.57
16 0.51
17 0.41
18 0.33
19 0.28
20 0.25
21 0.23
22 0.19
23 0.18
24 0.17
25 0.16
26 0.13
27 0.11
28 0.11
29 0.11
30 0.14
31 0.15
32 0.12
33 0.12
34 0.11
35 0.12
36 0.11
37 0.11
38 0.08
39 0.06
40 0.05
41 0.06
42 0.06
43 0.05
44 0.05
45 0.05
46 0.06
47 0.12
48 0.13
49 0.14
50 0.17
51 0.24
52 0.29
53 0.36
54 0.46
55 0.5
56 0.57
57 0.63
58 0.68
59 0.68
60 0.68
61 0.63
62 0.58
63 0.52
64 0.44
65 0.43
66 0.39
67 0.39
68 0.41
69 0.4
70 0.39
71 0.45
72 0.46
73 0.45
74 0.48
75 0.45
76 0.46
77 0.48
78 0.45
79 0.37
80 0.34
81 0.3
82 0.24