Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M9VW96

Protein Details
Accession A0A0M9VW96    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
179-212DPERAEKKAKNKDGPVKGRPGRPRKDKSAPPVVGBasic
NLS Segment(s)
PositionSequence
177-219KEDPERAEKKAKNKDGPVKGRPGRPRKDKSAPPVVGKTARKTR
Subcellular Location(s) nucl 14.5, cyto_nucl 13.833, cyto 11, mito_nucl 8.666
Family & Domain DBs
Amino Acid Sequences MDTSKPTINVTIPPPAPHKQAEEAAAKATEASGQAKGIESKVAPAAAHLIPKPVEVQSVPETPVNTASSVNGTPRPELNLSAMADEAEKPKRDDEGVLEPVTTAGDPASHADEPIVDIPVRQNGASEKSEAEKAEMAGALDPEEQESIKPTVETGMGEKRKLEDDAREVLKEAPAAKEDPERAEKKAKNKDGPVKGRPGRPRKDKSAPPVVGKTARKTRSQGPAEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.41
4 0.39
5 0.4
6 0.37
7 0.39
8 0.4
9 0.39
10 0.35
11 0.33
12 0.3
13 0.26
14 0.21
15 0.17
16 0.13
17 0.11
18 0.12
19 0.11
20 0.11
21 0.12
22 0.13
23 0.15
24 0.14
25 0.15
26 0.13
27 0.14
28 0.15
29 0.15
30 0.13
31 0.12
32 0.16
33 0.15
34 0.18
35 0.16
36 0.17
37 0.16
38 0.17
39 0.18
40 0.14
41 0.15
42 0.12
43 0.17
44 0.18
45 0.2
46 0.21
47 0.21
48 0.21
49 0.19
50 0.22
51 0.19
52 0.15
53 0.13
54 0.12
55 0.13
56 0.13
57 0.15
58 0.16
59 0.16
60 0.17
61 0.17
62 0.2
63 0.18
64 0.19
65 0.18
66 0.18
67 0.18
68 0.17
69 0.16
70 0.13
71 0.12
72 0.12
73 0.13
74 0.13
75 0.14
76 0.14
77 0.15
78 0.16
79 0.17
80 0.17
81 0.17
82 0.2
83 0.22
84 0.21
85 0.2
86 0.19
87 0.18
88 0.17
89 0.13
90 0.06
91 0.03
92 0.03
93 0.04
94 0.05
95 0.07
96 0.07
97 0.07
98 0.07
99 0.07
100 0.08
101 0.08
102 0.08
103 0.05
104 0.05
105 0.06
106 0.08
107 0.09
108 0.08
109 0.08
110 0.09
111 0.13
112 0.14
113 0.14
114 0.13
115 0.14
116 0.16
117 0.15
118 0.15
119 0.12
120 0.11
121 0.11
122 0.1
123 0.09
124 0.08
125 0.07
126 0.07
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.05
133 0.08
134 0.09
135 0.09
136 0.09
137 0.08
138 0.09
139 0.1
140 0.1
141 0.11
142 0.19
143 0.21
144 0.21
145 0.22
146 0.22
147 0.24
148 0.26
149 0.25
150 0.21
151 0.23
152 0.29
153 0.31
154 0.29
155 0.28
156 0.27
157 0.26
158 0.23
159 0.2
160 0.15
161 0.15
162 0.15
163 0.16
164 0.2
165 0.21
166 0.24
167 0.31
168 0.32
169 0.34
170 0.43
171 0.45
172 0.5
173 0.59
174 0.64
175 0.64
176 0.71
177 0.77
178 0.78
179 0.82
180 0.78
181 0.78
182 0.76
183 0.76
184 0.77
185 0.77
186 0.77
187 0.79
188 0.81
189 0.8
190 0.84
191 0.84
192 0.82
193 0.83
194 0.78
195 0.75
196 0.72
197 0.68
198 0.67
199 0.63
200 0.63
201 0.62
202 0.61
203 0.6
204 0.59
205 0.62
206 0.64