Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0N0RTC9

Protein Details
Accession A0A0N0RTC9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
27-49RPNPPSSTLGKRPRPSHHRHALGBasic
289-363GGWDQNGKKKQQRRPRLDEYRREESKRKEGRRHEESYKRERERERERERDRNRDRDRDYERHRDRHRDYDRDRRRBasic
NLS Segment(s)
PositionSequence
295-363GKKKQQRRPRLDEYRREESKRKEGRRHEESYKRERERERERERDRNRDRDRDYERHRDRHRDYDRDRRR
Subcellular Location(s) mito 14, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR045166  Spp2-like  
IPR026822  Spp2/MOS2_G-patch  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF12656  G-patch_2  
Amino Acid Sequences MSEPSRGRIAIKFGAGPAAPSSSRSSRPNPPSSTLGKRPRPSHHRHALGGASDSESEDDGDDDKHRERHERITGFGVEGAETEGGRRQAKAPKEYIIQRQANCSWKDAIRAKGKGQARDPSHPKAGSDREGDPREKDPVDEQKSLKWGLTIKERKPEAEEQATKTFESSKSSSSSSSKNRAEAPREEEKPRTADEEAMDALLGRMPQKKDLVIAQPSEDDAYRRDVEAAGAPSTLEDYEAMPVEEFGAALLRGMGWSGENLGPEVKQVRRRPNRLGLGAKELKEDEDLGGWDQNGKKKQQRRPRLDEYRREESKRKEGRRHEESYKRERERERERERDRNRDRDRDYERHRDRHRDYDRDRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.26
4 0.21
5 0.21
6 0.19
7 0.2
8 0.25
9 0.26
10 0.32
11 0.37
12 0.41
13 0.47
14 0.56
15 0.63
16 0.62
17 0.62
18 0.63
19 0.64
20 0.67
21 0.67
22 0.68
23 0.69
24 0.71
25 0.73
26 0.77
27 0.8
28 0.8
29 0.81
30 0.81
31 0.78
32 0.72
33 0.7
34 0.63
35 0.55
36 0.48
37 0.38
38 0.29
39 0.23
40 0.21
41 0.17
42 0.13
43 0.11
44 0.09
45 0.09
46 0.08
47 0.1
48 0.11
49 0.14
50 0.18
51 0.22
52 0.24
53 0.31
54 0.33
55 0.41
56 0.49
57 0.48
58 0.46
59 0.47
60 0.45
61 0.39
62 0.37
63 0.28
64 0.18
65 0.16
66 0.14
67 0.1
68 0.08
69 0.08
70 0.1
71 0.13
72 0.14
73 0.15
74 0.18
75 0.25
76 0.32
77 0.37
78 0.37
79 0.38
80 0.44
81 0.49
82 0.52
83 0.55
84 0.54
85 0.49
86 0.52
87 0.53
88 0.54
89 0.49
90 0.43
91 0.37
92 0.33
93 0.4
94 0.39
95 0.42
96 0.43
97 0.45
98 0.44
99 0.48
100 0.51
101 0.49
102 0.48
103 0.49
104 0.46
105 0.52
106 0.56
107 0.54
108 0.55
109 0.5
110 0.46
111 0.44
112 0.43
113 0.39
114 0.36
115 0.34
116 0.36
117 0.4
118 0.41
119 0.37
120 0.34
121 0.34
122 0.31
123 0.28
124 0.26
125 0.32
126 0.36
127 0.39
128 0.37
129 0.35
130 0.38
131 0.38
132 0.32
133 0.24
134 0.2
135 0.19
136 0.29
137 0.34
138 0.34
139 0.41
140 0.42
141 0.41
142 0.43
143 0.44
144 0.39
145 0.4
146 0.4
147 0.36
148 0.4
149 0.4
150 0.35
151 0.31
152 0.28
153 0.2
154 0.22
155 0.19
156 0.17
157 0.18
158 0.19
159 0.21
160 0.21
161 0.27
162 0.28
163 0.35
164 0.34
165 0.34
166 0.39
167 0.41
168 0.43
169 0.41
170 0.41
171 0.4
172 0.43
173 0.43
174 0.39
175 0.37
176 0.34
177 0.31
178 0.28
179 0.21
180 0.2
181 0.17
182 0.17
183 0.15
184 0.13
185 0.11
186 0.08
187 0.07
188 0.06
189 0.06
190 0.06
191 0.1
192 0.11
193 0.14
194 0.15
195 0.16
196 0.16
197 0.19
198 0.23
199 0.22
200 0.22
201 0.2
202 0.19
203 0.19
204 0.19
205 0.15
206 0.11
207 0.09
208 0.13
209 0.13
210 0.13
211 0.13
212 0.12
213 0.13
214 0.15
215 0.16
216 0.12
217 0.11
218 0.1
219 0.1
220 0.1
221 0.09
222 0.06
223 0.05
224 0.05
225 0.06
226 0.07
227 0.07
228 0.06
229 0.06
230 0.07
231 0.06
232 0.05
233 0.04
234 0.05
235 0.04
236 0.04
237 0.04
238 0.03
239 0.03
240 0.04
241 0.04
242 0.03
243 0.04
244 0.06
245 0.07
246 0.08
247 0.08
248 0.09
249 0.09
250 0.1
251 0.15
252 0.17
253 0.25
254 0.33
255 0.43
256 0.53
257 0.6
258 0.66
259 0.71
260 0.74
261 0.73
262 0.72
263 0.64
264 0.64
265 0.62
266 0.55
267 0.47
268 0.4
269 0.33
270 0.27
271 0.25
272 0.16
273 0.12
274 0.13
275 0.12
276 0.13
277 0.12
278 0.15
279 0.18
280 0.24
281 0.28
282 0.34
283 0.41
284 0.5
285 0.6
286 0.66
287 0.74
288 0.78
289 0.82
290 0.86
291 0.89
292 0.9
293 0.9
294 0.87
295 0.86
296 0.83
297 0.8
298 0.77
299 0.74
300 0.75
301 0.75
302 0.77
303 0.77
304 0.8
305 0.84
306 0.84
307 0.84
308 0.83
309 0.82
310 0.81
311 0.82
312 0.82
313 0.79
314 0.78
315 0.79
316 0.79
317 0.8
318 0.82
319 0.82
320 0.82
321 0.84
322 0.87
323 0.88
324 0.89
325 0.87
326 0.87
327 0.86
328 0.86
329 0.82
330 0.82
331 0.82
332 0.81
333 0.8
334 0.8
335 0.8
336 0.8
337 0.83
338 0.84
339 0.82
340 0.82
341 0.83
342 0.83
343 0.82