Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0M8N8F3

Protein Details
Accession A0A0M8N8F3    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPAAGAKKQKKKWSKGKTKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
6-22GAKKQKKKWSKGKTKDK
Subcellular Location(s) cyto 9, nucl 8, mito 5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAGAKKQKKKWSKGKTKDKAQHAVILDKTTSEKLYKDVQSWRLVTIAILVDRMKINGSLARQCLKDLEEKGIVKPVITHSKMKIYTRAIGEGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.89
4 0.92
5 0.92
6 0.93
7 0.91
8 0.89
9 0.85
10 0.76
11 0.71
12 0.62
13 0.57
14 0.48
15 0.41
16 0.32
17 0.24
18 0.24
19 0.19
20 0.18
21 0.13
22 0.13
23 0.14
24 0.2
25 0.21
26 0.23
27 0.28
28 0.3
29 0.33
30 0.33
31 0.31
32 0.25
33 0.23
34 0.19
35 0.15
36 0.11
37 0.07
38 0.07
39 0.07
40 0.08
41 0.08
42 0.08
43 0.07
44 0.07
45 0.08
46 0.09
47 0.12
48 0.14
49 0.17
50 0.2
51 0.2
52 0.2
53 0.2
54 0.2
55 0.23
56 0.21
57 0.24
58 0.26
59 0.27
60 0.27
61 0.32
62 0.31
63 0.25
64 0.25
65 0.27
66 0.31
67 0.33
68 0.36
69 0.33
70 0.42
71 0.47
72 0.48
73 0.49
74 0.44
75 0.48
76 0.47