Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M8N0R2

Protein Details
Accession A0A0M8N0R2   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
231-260AEDNKPKPKSILKPKPKPKPQELRAHNEKSBasic
NLS Segment(s)
PositionSequence
233-254DNKPKPKSILKPKPKPKPQELR
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036282  Glutathione-S-Trfase_C_sf  
IPR004046  GST_C  
IPR036249  Thioredoxin-like_sf  
Pfam View protein in Pfam  
PF14497  GST_C_3  
Amino Acid Sequences MNAAYELFHQQDFFSFGELIRIMFQEACVPYLNYAKLNKRYIDNMYKNRAGDEFNPPIYTHPVLRHGRVVICDVPNIMLYLAPRLGLGTDPMLTPGLNHRNCPAALYHMNQLTSILLKDFVGELEFLMRPIFHLRHPERDIEYLKCRFQRYVDLRLPTIMEFLQNMLQGPNSSGGPWLFGHRFTYVDIVLFYKKEPKTKSHTNRDVEKTPSEDDKAKSAIKAGTTEKLKVAEDNKPKPKSILKPKPKPKPQELRAHNEKSATSVSVESKPADHKKNAEKKAPAEDEGLFSGLLKIIPPRRNKGAETRAKNKTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.14
4 0.17
5 0.17
6 0.16
7 0.14
8 0.14
9 0.13
10 0.13
11 0.13
12 0.15
13 0.16
14 0.17
15 0.17
16 0.17
17 0.18
18 0.22
19 0.24
20 0.22
21 0.28
22 0.35
23 0.42
24 0.47
25 0.48
26 0.47
27 0.5
28 0.54
29 0.58
30 0.59
31 0.6
32 0.62
33 0.63
34 0.6
35 0.57
36 0.5
37 0.43
38 0.37
39 0.37
40 0.35
41 0.32
42 0.33
43 0.31
44 0.32
45 0.32
46 0.31
47 0.25
48 0.23
49 0.31
50 0.33
51 0.35
52 0.36
53 0.34
54 0.34
55 0.33
56 0.33
57 0.29
58 0.26
59 0.25
60 0.21
61 0.19
62 0.17
63 0.16
64 0.12
65 0.08
66 0.08
67 0.09
68 0.09
69 0.08
70 0.08
71 0.08
72 0.08
73 0.07
74 0.08
75 0.07
76 0.07
77 0.07
78 0.08
79 0.09
80 0.08
81 0.08
82 0.15
83 0.23
84 0.24
85 0.24
86 0.25
87 0.28
88 0.28
89 0.29
90 0.22
91 0.19
92 0.21
93 0.22
94 0.25
95 0.23
96 0.23
97 0.22
98 0.22
99 0.16
100 0.14
101 0.11
102 0.08
103 0.06
104 0.06
105 0.07
106 0.06
107 0.06
108 0.06
109 0.05
110 0.05
111 0.07
112 0.07
113 0.07
114 0.07
115 0.06
116 0.07
117 0.1
118 0.12
119 0.11
120 0.21
121 0.23
122 0.31
123 0.33
124 0.36
125 0.34
126 0.37
127 0.38
128 0.32
129 0.37
130 0.32
131 0.33
132 0.34
133 0.33
134 0.3
135 0.28
136 0.35
137 0.33
138 0.39
139 0.4
140 0.38
141 0.37
142 0.36
143 0.36
144 0.25
145 0.22
146 0.13
147 0.08
148 0.07
149 0.07
150 0.08
151 0.08
152 0.08
153 0.07
154 0.07
155 0.07
156 0.07
157 0.08
158 0.06
159 0.06
160 0.07
161 0.07
162 0.09
163 0.09
164 0.11
165 0.11
166 0.12
167 0.13
168 0.13
169 0.14
170 0.12
171 0.14
172 0.11
173 0.1
174 0.1
175 0.1
176 0.1
177 0.1
178 0.1
179 0.16
180 0.18
181 0.24
182 0.27
183 0.31
184 0.38
185 0.49
186 0.58
187 0.61
188 0.69
189 0.68
190 0.74
191 0.75
192 0.72
193 0.64
194 0.56
195 0.49
196 0.42
197 0.39
198 0.33
199 0.32
200 0.28
201 0.28
202 0.29
203 0.27
204 0.24
205 0.24
206 0.23
207 0.2
208 0.23
209 0.22
210 0.25
211 0.26
212 0.27
213 0.26
214 0.26
215 0.26
216 0.26
217 0.27
218 0.3
219 0.37
220 0.45
221 0.53
222 0.54
223 0.54
224 0.55
225 0.59
226 0.6
227 0.62
228 0.64
229 0.65
230 0.73
231 0.83
232 0.9
233 0.91
234 0.9
235 0.89
236 0.89
237 0.86
238 0.86
239 0.84
240 0.82
241 0.83
242 0.79
243 0.7
244 0.62
245 0.53
246 0.46
247 0.4
248 0.32
249 0.23
250 0.21
251 0.22
252 0.23
253 0.25
254 0.22
255 0.23
256 0.3
257 0.37
258 0.41
259 0.42
260 0.46
261 0.55
262 0.65
263 0.7
264 0.7
265 0.69
266 0.67
267 0.73
268 0.69
269 0.61
270 0.54
271 0.47
272 0.41
273 0.36
274 0.32
275 0.21
276 0.17
277 0.15
278 0.13
279 0.12
280 0.1
281 0.15
282 0.23
283 0.3
284 0.37
285 0.44
286 0.52
287 0.57
288 0.61
289 0.64
290 0.67
291 0.7
292 0.72
293 0.74