Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M9VS02

Protein Details
Accession A0A0M9VS02    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-21SIPPQLIRVKRKRDDDSPVTHydrophilic
NLS Segment(s)
PositionSequence
248-267KKKEAAERPKFRPKAPEKRY
Subcellular Location(s) nucl 13.5, mito 9, cyto_nucl 9, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040150  Iwr1  
IPR013883  TF_Iwr1_dom  
Gene Ontology GO:0006606  P:protein import into nucleus  
Pfam View protein in Pfam  
PF08574  Iwr1  
Amino Acid Sequences MSIPPQLIRVKRKRDDDSPVTFLQLEEGSKRHRSGKSNWVYQRRGSTAAAAAAAASRGGVPAISRNDAKPVIHVSRLEEGVAEGAHDGTGTEAGAGDGGDASPKRRKFHVSRAMLSQAPAALRHARSGPTMFVERGRNKIAPKPALAAKNVGLGAAAAPGQRPGSESPLRAGVEPAEPAEQRRLHRPGVANRSRNASRDAPCETPTRSPLPESLTKRHVEDMDRIVADMNEWVLNELGSNLRSMEAEKKKEAAERPKFRPKAPEKRYSERHPERQAVPTNEHADTPMADASEEEDTDEDWIIEEYVRVPAQSVALDISPSDIGILVLDGEKETMLFYGPPQDEDEDADEDDEDENAENHYTADYPEDEVDSDDEFDRHAYMFRNANASDDEEFDDDEYDDDDSDEMVMEGDDDDDARMSRIRAFMHRNPGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.78
4 0.76
5 0.71
6 0.64
7 0.57
8 0.49
9 0.41
10 0.34
11 0.27
12 0.21
13 0.18
14 0.21
15 0.24
16 0.29
17 0.32
18 0.37
19 0.42
20 0.47
21 0.51
22 0.59
23 0.63
24 0.68
25 0.74
26 0.76
27 0.73
28 0.72
29 0.73
30 0.65
31 0.59
32 0.5
33 0.44
34 0.37
35 0.34
36 0.29
37 0.21
38 0.17
39 0.13
40 0.12
41 0.09
42 0.06
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.11
49 0.15
50 0.19
51 0.21
52 0.21
53 0.27
54 0.29
55 0.29
56 0.26
57 0.3
58 0.3
59 0.31
60 0.32
61 0.3
62 0.32
63 0.33
64 0.29
65 0.22
66 0.18
67 0.16
68 0.14
69 0.11
70 0.06
71 0.06
72 0.06
73 0.05
74 0.05
75 0.04
76 0.05
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.03
86 0.06
87 0.07
88 0.11
89 0.18
90 0.22
91 0.25
92 0.29
93 0.38
94 0.43
95 0.54
96 0.61
97 0.61
98 0.6
99 0.63
100 0.63
101 0.55
102 0.48
103 0.37
104 0.28
105 0.21
106 0.18
107 0.16
108 0.17
109 0.17
110 0.18
111 0.19
112 0.19
113 0.21
114 0.22
115 0.2
116 0.19
117 0.21
118 0.19
119 0.22
120 0.29
121 0.29
122 0.32
123 0.35
124 0.34
125 0.34
126 0.4
127 0.43
128 0.39
129 0.37
130 0.37
131 0.39
132 0.39
133 0.38
134 0.34
135 0.27
136 0.27
137 0.25
138 0.21
139 0.15
140 0.11
141 0.1
142 0.08
143 0.08
144 0.04
145 0.05
146 0.06
147 0.06
148 0.06
149 0.08
150 0.09
151 0.15
152 0.18
153 0.19
154 0.19
155 0.23
156 0.24
157 0.22
158 0.21
159 0.16
160 0.14
161 0.14
162 0.13
163 0.11
164 0.11
165 0.12
166 0.17
167 0.19
168 0.2
169 0.27
170 0.3
171 0.29
172 0.34
173 0.38
174 0.41
175 0.48
176 0.55
177 0.51
178 0.48
179 0.54
180 0.51
181 0.46
182 0.43
183 0.38
184 0.33
185 0.33
186 0.35
187 0.31
188 0.31
189 0.33
190 0.3
191 0.26
192 0.26
193 0.26
194 0.23
195 0.22
196 0.22
197 0.23
198 0.29
199 0.31
200 0.33
201 0.34
202 0.34
203 0.34
204 0.34
205 0.31
206 0.26
207 0.25
208 0.24
209 0.22
210 0.21
211 0.2
212 0.18
213 0.15
214 0.13
215 0.1
216 0.07
217 0.05
218 0.05
219 0.05
220 0.05
221 0.05
222 0.04
223 0.05
224 0.05
225 0.05
226 0.05
227 0.05
228 0.06
229 0.06
230 0.07
231 0.16
232 0.21
233 0.24
234 0.25
235 0.27
236 0.28
237 0.33
238 0.38
239 0.4
240 0.44
241 0.49
242 0.56
243 0.65
244 0.66
245 0.64
246 0.68
247 0.67
248 0.68
249 0.67
250 0.7
251 0.67
252 0.73
253 0.79
254 0.76
255 0.77
256 0.75
257 0.76
258 0.72
259 0.71
260 0.64
261 0.64
262 0.64
263 0.57
264 0.51
265 0.47
266 0.44
267 0.39
268 0.36
269 0.29
270 0.22
271 0.19
272 0.17
273 0.12
274 0.09
275 0.08
276 0.08
277 0.09
278 0.09
279 0.08
280 0.07
281 0.07
282 0.07
283 0.08
284 0.08
285 0.06
286 0.05
287 0.06
288 0.06
289 0.05
290 0.06
291 0.06
292 0.08
293 0.08
294 0.08
295 0.08
296 0.09
297 0.1
298 0.1
299 0.09
300 0.08
301 0.08
302 0.08
303 0.07
304 0.08
305 0.07
306 0.07
307 0.06
308 0.05
309 0.05
310 0.05
311 0.05
312 0.04
313 0.04
314 0.05
315 0.05
316 0.05
317 0.05
318 0.05
319 0.05
320 0.05
321 0.05
322 0.05
323 0.06
324 0.14
325 0.15
326 0.16
327 0.18
328 0.19
329 0.19
330 0.21
331 0.23
332 0.16
333 0.16
334 0.15
335 0.13
336 0.13
337 0.12
338 0.1
339 0.08
340 0.06
341 0.07
342 0.07
343 0.08
344 0.07
345 0.07
346 0.08
347 0.08
348 0.07
349 0.1
350 0.1
351 0.12
352 0.12
353 0.13
354 0.13
355 0.13
356 0.14
357 0.12
358 0.13
359 0.12
360 0.11
361 0.11
362 0.11
363 0.11
364 0.1
365 0.12
366 0.13
367 0.17
368 0.23
369 0.24
370 0.29
371 0.28
372 0.3
373 0.29
374 0.3
375 0.26
376 0.23
377 0.23
378 0.19
379 0.19
380 0.17
381 0.16
382 0.13
383 0.12
384 0.11
385 0.1
386 0.09
387 0.09
388 0.08
389 0.07
390 0.07
391 0.07
392 0.06
393 0.06
394 0.05
395 0.05
396 0.05
397 0.05
398 0.05
399 0.06
400 0.06
401 0.07
402 0.08
403 0.09
404 0.11
405 0.12
406 0.16
407 0.19
408 0.23
409 0.3
410 0.39
411 0.45