Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0M9VRM8

Protein Details
Accession A0A0M9VRM8    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
107-131DKARVLEKTKKRNIHFPQRKFAIKAHydrophilic
NLS Segment(s)
PositionSequence
93-128PKQTRAIRRRLSPEDKARVLEKTKKRNIHFPQRKFA
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MEEEDLVTSSSKVKAAQLWGKNKDELAKQLGELKAELGQLRIQKVASSGSKLNRINDLRKSIARVLTVTNATQRNQLRLFYKKSKYLPLDLRPKQTRAIRRRLSPEDKARVLEKTKKRNIHFPQRKFAIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.26
3 0.34
4 0.4
5 0.47
6 0.52
7 0.55
8 0.54
9 0.51
10 0.48
11 0.43
12 0.39
13 0.34
14 0.29
15 0.26
16 0.31
17 0.31
18 0.27
19 0.23
20 0.2
21 0.17
22 0.17
23 0.17
24 0.11
25 0.13
26 0.15
27 0.16
28 0.16
29 0.14
30 0.13
31 0.14
32 0.17
33 0.15
34 0.16
35 0.19
36 0.21
37 0.28
38 0.3
39 0.3
40 0.33
41 0.36
42 0.37
43 0.38
44 0.4
45 0.35
46 0.34
47 0.36
48 0.31
49 0.3
50 0.26
51 0.22
52 0.18
53 0.18
54 0.18
55 0.15
56 0.17
57 0.17
58 0.17
59 0.22
60 0.22
61 0.24
62 0.24
63 0.27
64 0.27
65 0.3
66 0.37
67 0.39
68 0.43
69 0.45
70 0.47
71 0.52
72 0.51
73 0.53
74 0.54
75 0.54
76 0.61
77 0.58
78 0.65
79 0.61
80 0.6
81 0.59
82 0.59
83 0.6
84 0.58
85 0.64
86 0.62
87 0.65
88 0.72
89 0.74
90 0.74
91 0.73
92 0.75
93 0.72
94 0.68
95 0.63
96 0.57
97 0.53
98 0.53
99 0.53
100 0.53
101 0.56
102 0.63
103 0.69
104 0.71
105 0.76
106 0.79
107 0.81
108 0.82
109 0.79
110 0.81
111 0.79