Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0M8N2L5

Protein Details
Accession A0A0M8N2L5    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
30-71EIKVKMPKTPKSPKAPKSPKTPKTPKTPKTPKAPKEPKTPKABasic
NLS Segment(s)
PositionSequence
33-115VKMPKTPKSPKAPKSPKTPKTPKTPKTPKAPKEPKTPKAPKAPKAPKVPKEPKGPKEPRERREPRPPRVRLPGQRGPGRPRKV
Subcellular Location(s) nucl 15.5, mito_nucl 11, cyto 6, mito 5.5
Family & Domain DBs
Amino Acid Sequences MVVLCQGPQVPAGASLAQVQTPPSTPEAEEIKVKMPKTPKSPKAPKSPKTPKTPKTPKTPKAPKEPKTPKAPKAPKAPKVPKEPKGPKEPRERREPRPPRVRLPGQRGPGRPRKVLRTSAPVWYCCACQSGPWLEPTTPACIECCHATCNECTVTDVMPHHYYEVATVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.13
4 0.12
5 0.12
6 0.12
7 0.12
8 0.13
9 0.15
10 0.14
11 0.15
12 0.15
13 0.19
14 0.22
15 0.22
16 0.24
17 0.23
18 0.28
19 0.31
20 0.3
21 0.31
22 0.34
23 0.39
24 0.46
25 0.55
26 0.57
27 0.64
28 0.74
29 0.77
30 0.82
31 0.85
32 0.82
33 0.83
34 0.85
35 0.82
36 0.83
37 0.85
38 0.81
39 0.82
40 0.86
41 0.82
42 0.82
43 0.84
44 0.81
45 0.82
46 0.85
47 0.81
48 0.81
49 0.84
50 0.79
51 0.8
52 0.82
53 0.78
54 0.78
55 0.79
56 0.75
57 0.76
58 0.77
59 0.73
60 0.74
61 0.77
62 0.74
63 0.77
64 0.79
65 0.75
66 0.78
67 0.79
68 0.75
69 0.76
70 0.77
71 0.72
72 0.74
73 0.73
74 0.7
75 0.73
76 0.75
77 0.69
78 0.72
79 0.73
80 0.69
81 0.74
82 0.76
83 0.74
84 0.76
85 0.76
86 0.71
87 0.74
88 0.75
89 0.72
90 0.71
91 0.69
92 0.65
93 0.67
94 0.66
95 0.65
96 0.65
97 0.62
98 0.6
99 0.57
100 0.58
101 0.58
102 0.6
103 0.57
104 0.55
105 0.52
106 0.54
107 0.53
108 0.45
109 0.42
110 0.36
111 0.32
112 0.25
113 0.25
114 0.17
115 0.14
116 0.18
117 0.2
118 0.2
119 0.23
120 0.25
121 0.22
122 0.26
123 0.27
124 0.27
125 0.23
126 0.22
127 0.2
128 0.18
129 0.21
130 0.21
131 0.21
132 0.18
133 0.18
134 0.2
135 0.21
136 0.24
137 0.23
138 0.19
139 0.2
140 0.19
141 0.19
142 0.21
143 0.21
144 0.23
145 0.23
146 0.23
147 0.22
148 0.22
149 0.21